ID4 Antibody - #DF3183
| Product: | ID4 Antibody |
| Catalog: | DF3183 |
| Description: | Rabbit polyclonal antibody to ID4 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Dog |
| Mol.Wt.: | 24 KD; 17kD(Calculated). |
| Uniprot: | P47928 |
| RRID: | AB_2835406 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3183, RRID:AB_2835406.
Fold/Unfold
bHLHb27; Class B basic helix-loop-helix protein 27; DNA binding protein inhibitor ID 4; DNA binding protein inhibitor ID4; DNA-binding protein inhibitor ID-4; ID 4; Id4; ID4_HUMAN; IDB4; Inhibitor of DNA binding 4; Inhibitor of DNA binding 4 dominant negative helix loop helix protein;
Immunogens
- P47928 ID4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P47928 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S5 | Phosphorylation | Uniprot | |
| R49 | Methylation | Uniprot |
Research Backgrounds
Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation (By similarity).
Nucleus.
Heterodimer with other HLH proteins.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells. (View pathway)
· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.