Blimp-1 Antibody - #AF4088
Product: | Blimp-1 Antibody |
Catalog: | AF4088 |
Description: | Rabbit polyclonal antibody to Blimp-1 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 92-100kD; 92kD(Calculated). |
Uniprot: | O75626 |
RRID: | AB_2835354 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF4088, RRID:AB_2835354.
Fold/Unfold
B Lymphocyte Induced Maturation Protein 1; Beta interferon gene positive regulatory domain I binding factor; Beta-interferon gene positive regulatory domain I-binding factor; BLIMP-1; BLIMP1; Positive Regulatory Domain I Binding Factor 1; Positive regulatory domain I-binding factor 1; PR Domain Containing 1; PR domain containing 1 with ZNF domain; PR domain containing 1 with ZNF domain isoform 2; PR domain containing protein 1; PR domain zinc finger protein 1; PR domain-containing protein 1; PRDI BF1; PRDI binding factor 1; PRDI-BF1; PRDI-binding factor 1; PRDM 1; Prdm1; PRDM1_HUMAN;
Immunogens
- O75626 PRDM1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLDICLEKRVGTTLAAPKCNSSTVRFQGLAEGTKGTMKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQTQSSLKQPSTEKNELCPKNVPKREYSVKEILKLDSNPSKGKDLYRSNISPLTSEKDLDDFRRRGSPEMPFYPRVVYPIRAPLPEDFLKASLAYGIERPTYITRSPIPSSTTPSPSARSSPDQSLKSSSPHSSPGNTVSPVGPGSQEHRDSYAYLNASYGTEGLGSYPGYAPLPHLPPAFIPSYNAHYPKFLLPPYGMNCNGLSAVSSMNGINNFGLFPRLCPVYSNLLGGGSLPHPMLNPTSLPSSLPSDGARRLLQPEHPREVLVPAPHSAFSFTGAAASMKDKACSPTSGSPTAGTAATAEHVVQPKATSAAMAAPSSDEAMNLIKNKRNMTGYKTLPYPLKKQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCSQCHKNYIHLCSLKVHLKGNCAAAPAPGLPLEDLTRINEEIEKFDISDNADRLEDVEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNMGNGLLSSGCSLYESSDLPLMKLPPSNPLPLVPVKVKQETVEPMDP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O75626 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S21 | Phosphorylation | Uniprot | |
T23 | Phosphorylation | Uniprot | |
S227 | Phosphorylation | Uniprot | |
S272 | Phosphorylation | Uniprot | |
K278 | Ubiquitination | Uniprot | |
S288 | Phosphorylation | Uniprot | |
S342 | Phosphorylation | Uniprot | |
S351 | Phosphorylation | Uniprot | |
S355 | Phosphorylation | Uniprot | |
T359 | Phosphorylation | Uniprot | |
S361 | Phosphorylation | Uniprot | |
R371 | Methylation | Uniprot | |
S511 | Phosphorylation | Uniprot | |
T518 | Phosphorylation | Uniprot | |
S641 | Phosphorylation | Uniprot | |
K678 | Acetylation | Uniprot | |
K816 | Sumoylation | Uniprot |
Research Backgrounds
Transcription factor that mediates a transcriptional program in various innate and adaptive immune tissue-resident lymphocyte T cell types such as tissue-resident memory T (Trm), natural killer (trNK) and natural killer T (NKT) cells and negatively regulates gene expression of proteins that promote the egress of tissue-resident T-cell populations from non-lymphoid organs. Plays a role in the development, retention and long-term establishment of adaptive and innate tissue-resident lymphocyte T cell types in non-lymphoid organs, such as the skin and gut, but also in other nonbarrier tissues like liver and kidney, and therefore may provide immediate immunological protection against reactivating infections or viral reinfection (By similarity). Binds specifically to the PRDI element in the promoter of the beta-interferon gene. Drives the maturation of B-lymphocytes into Ig secreting cells. Associates with the transcriptional repressor ZNF683 to chromatin at gene promoter regions (By similarity).
Sumoylation at Lys-816 by PIAS1 augments transcriptional repressor activity, and is critical for plasma cell differentiation.
Ubiquitinated by the SCF(FBXO11) complex, leading to its degradation by the proteasome.
Nucleus. Cytoplasm.
Interacts with PRMT5 (By similarity). Interacts with FBXO10. Interacts with FBXO11.
Belongs to the class V-like SAM-binding methyltransferase superfamily.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.