Cox1 Antibody - #AF7002
Product: | Cox1 Antibody |
Catalog: | AF7002 |
Description: | Rabbit polyclonal antibody to Cox1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat, Pig |
Prediction: | Pig, Horse, Rabbit, Dog |
Mol.Wt.: | 70kDa; 69kD(Calculated). |
Uniprot: | P23219 |
RRID: | AB_2835310 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF7002, RRID:AB_2835310.
Fold/Unfold
COX 1; COX 3; COX-1; COX1; Cox3; Cyclooxygenase 1; Cyclooxygenase 3, included; Cyclooxygenase-1; EC 1.14.99.1; Partial COX1 proteins, included; PCOX1; PGG/HS; PGH synthase 1; PGH1_HUMAN; PGHS-1; PGHS1; PHS 1; PHS1; Prostaglandin G/H synthase 1; Prostaglandin H2 synthase 1; Prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase); Prostaglandin-endoperoxide synthase 1; PTGHS; PTGS1;
Immunogens
- P23219 PGH1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P23219 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y54 | Phosphorylation | Uniprot | |
T117 | Phosphorylation | Uniprot | |
T220 | Phosphorylation | Uniprot |
Research Backgrounds
Converts arachidonate to prostaglandin H2 (PGH2), a committed step in prostanoid synthesis. Involved in the constitutive production of prostanoids in particular in the stomach and platelets. In gastric epithelial cells, it is a key step in the generation of prostaglandins, such as prostaglandin E2 (PGE2), which plays an important role in cytoprotection. In platelets, it is involved in the generation of thromboxane A2 (TXA2), which promotes platelet activation and aggregation, vasoconstriction and proliferation of vascular smooth muscle cells.
Microsome membrane>Peripheral membrane protein. Endoplasmic reticulum membrane>Peripheral membrane protein.
Homodimer.
Belongs to the prostaglandin G/H synthase family.
Research Fields
· Metabolism > Lipid metabolism > Arachidonic acid metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Immune system > Platelet activation. (View pathway)
· Organismal Systems > Nervous system > Serotonergic synapse.
· Organismal Systems > Endocrine system > Regulation of lipolysis in adipocytes.
References
Application: WB Species: Mouse Sample: Hep2 cells
Application: WB Species: human Sample: Hep2 cells
Application: WB Species: Rat Sample:
Application: IF/ICC Species: Rat Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.