Collagen I Antibody - #AF7001

(233)   (155)  
Product: Collagen I Antibody
Catalog: AF7001
Description: Rabbit polyclonal antibody to Collagen I
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat, Bovine
Prediction: Pig, Zebrafish, Bovine, Horse, Dog, Chicken
Mol.Wt.: 130-200 kDa; 139kD,129kD(Calculated).
Uniprot: P02452 | P08123
RRID: AB_2835309

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Bovine
Prediction:
Pig(100%), Zebrafish(89%), Horse(100%), Dog(100%), Chicken(89%)
Clonality:
Polyclonal
Specificity:
Collagen I Antibody detects endogenous levels of total Collagen I.
RRID:
AB_2835309
Cite Format: Affinity Biosciences Cat# AF7001, RRID:AB_2835309.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Alpha 1 type I collagen; Alpha 2 type I collagen; alpha 2 type I procollagen; alpha 2(I) procollagen; alpha 2(I)-collagen; Alpha-1 type I collagen; alpha1(I) procollagen; CO1A1_HUMAN; COL1A1; COL1A2; collagen alpha 1 chain type I; Collagen alpha-1(I) chain; collagen alpha-1(I) chain preproprotein; Collagen I alpha 1 polypeptide; Collagen I alpha 2 polypeptide; collagen of skin, tendon and bone, alpha-1 chain; collagen of skin, tendon and bone, alpha-2 chain; Collagen type I alpha 1; Collagen type I alpha 2; EDSC; OI1; OI2; OI3; OI4; pro-alpha-1 collagen type 1; type I proalpha 1; type I procollagen alpha 1 chain; Type I procollagen;

Immunogens

Immunogen:

A synthesized peptide derived from human Collagen I, corresponding to a region within N-terminal amino acids.

Uniprot:

P02452(CO1A1_HUMAN) >>Visit HPA database.

P08123(CO1A2_HUMAN) >>Visit HPA database.

Gene(ID):
COL1A2(1278) | COL1A1(1277)
Expression:
P02452 CO1A1_HUMAN:

Forms the fibrils of tendon, ligaments and bones. In bones the fibrils are mineralized with calcium hydroxyapatite.

P08123 CO1A2_HUMAN:

Forms the fibrils of tendon, ligaments and bones. In bones the fibrils are mineralized with calcium hydroxyapatite.

Description:
This gene encodes one of the chains for type I collagen, the fibrillar collagen found in most connective tissues. Mutations in this gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. Symptoms associated with mutations in this gene, however, tend to be less severe than mutations in the gene for alpha-1 type I collagen since alpha-2 is less abundant.
Sequence:
MFSFVDLRLLLLLAATALLTHGQEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQLSYGYDEKSTGGISVPGPMGPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRPGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGPRGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGPGGPPGPKGNSGEPGAPGSKGDTGAKGEPGPVGVQGPPGPAGEEGKRGARGEPGPTGLPGPPGERGGPGSRGFPGADGVAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGVPGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGDKGESGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGPPGPAGPAGPPGPIGNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPAGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPGPQGIAGQRGVVGLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGAPGAEGSPGRDGSPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPAGPTGPVGPVGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQGSNEIEIRAEGNSRFTYSVTVDGCTSHTGAWGKTVIEYKTTKTSRLPIIDVAPLDVGAPDQEFGFDVGPVCFL

MLSFVDTRTLLLLAVTLCLATCQSLQEETVRKGPAGDRGPRGERGPPGPPGRDGEDGPTGPPGPPGPPGPPGLGGNFAAQYDGKGVGLGPGPMGLMGPRGPPGAAGAPGPQGFQGPAGEPGEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAAGPTGPIGSRGPSGPPGPDGNKGEPGVVGAVGTAGPSGPSGLPGERGAAGIPGGKGEKGEPGLRGEIGNPGRDGARGAPGAVGAPGPAGATGDRGEAGAAGPAGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGERGAKGPKGENGVVGPTGPVGAAGPAGPNGPPGPAGSRGDGGPPGMTGFPGAAGRTGPPGPSGISGPPGPPGPAGKEGLRGPRGDQGPVGRTGEVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGAVGEPGPLGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNIGPVGAAGAPGPHGPVGPAGKHGNRGETGPSGPVGPAGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Dog
100
Zebrafish
89
Chicken
89
Xenopus
78
Sheep
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P02452/P08123 As Substrate

Site PTM Type Enzyme
K198 Acetylation
T209 Phosphorylation
S251 Phosphorylation
S389 Phosphorylation
S401 Phosphorylation
S404 Phosphorylation
S710 Phosphorylation
T981 Phosphorylation
K1064 Acetylation
T1073 Phosphorylation
S1104 Phosphorylation
S1124 Phosphorylation
T1138 O-Glycosylation
T1138 Phosphorylation
S1141 Phosphorylation
T1148 Phosphorylation
S1155 Phosphorylation
S1295 Phosphorylation

Research Backgrounds

Function:

Type I collagen is a member of group I collagen (fibrillar forming collagen).

PTMs:

Contains mostly 4-hydroxyproline. Proline residues at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains.

Contains 3-hydroxyproline at a few sites. This modification occurs on the first proline residue in the sequence motif Gly-Pro-Hyp, where Hyp is 4-hydroxyproline.

Lysine residues at the third position of the tripeptide repeating unit (G-X-Y) are 5-hydroxylated in some or all of the chains.

O-glycosylated on hydroxylated lysine residues. The O-linked glycan consists of a Glc-Gal disaccharide.

Subcellular Location:

Secreted>Extracellular space>Extracellular matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Forms the fibrils of tendon, ligaments and bones. In bones the fibrils are mineralized with calcium hydroxyapatite.

Subunit Structure:

Trimers of one alpha 2(I) and two alpha 1(I) chains. Interacts with MRC2 (By similarity). Interacts with TRAM2. Interacts with MFAP4 in a Ca (2+)-dependent manner (By similarity).

Family&Domains:

The C-terminal propeptide, also known as COLFI domain, have crucial roles in tissue growth and repair by controlling both the intracellular assembly of procollagen molecules and the extracellular assembly of collagen fibrils. It binds a calcium ion which is essential for its function (By similarity).

Belongs to the fibrillar collagen family.

Function:

Type I collagen is a member of group I collagen (fibrillar forming collagen).

PTMs:

Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains.

Subcellular Location:

Secreted>Extracellular space>Extracellular matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Forms the fibrils of tendon, ligaments and bones. In bones the fibrils are mineralized with calcium hydroxyapatite.

Subunit Structure:

Trimers of one alpha 2(I) and two alpha 1(I) chains.

Family&Domains:

The C-terminal propeptide, also known as COLFI domain, have crucial roles in tissue growth and repair by controlling both the intracellular assembly of procollagen molecules and the extracellular assembly of collagen fibrils. It binds a calcium ion which is essential for its function.

Belongs to the fibrillar collagen family.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > ECM-receptor interaction.   (View pathway)

· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Organismal Systems > Immune system > Platelet activation.   (View pathway)

· Organismal Systems > Endocrine system > Relaxin signaling pathway.

· Organismal Systems > Digestive system > Protein digestion and absorption.

References

1). Realizing Highly Efficient Sonodynamic Bactericidal Capability through the Phonon–Electron Coupling Effect Using Two-Dimensional Catalytic Planar Defects. Advanced Materials, 2023 (PubMed: 36524686) [IF=29.4]

Application: WB    Species: Mouse    Sample:

Figure 7 Inflammatory response and bone repair ability in MRSA-infected bony tissue in vivo. The fluorescent images of a) tumor necrosis factor-alpha (TNF-α), c) interleukin-10 (IL-10), e) Runt-related transcription factor 2 (Runx-2), g) Collagen type I (COL I) and the corresponding mean optical intensity of b) TNF-α, d) IL-10, f) Runx-2, and h) COL I in the MRSA-infected bony tissues after treated with different samples for 14 days. The higher mean optical intensity indicates the more expression of the related proteins. Scale bars: 20 µm. Data were taken from independent samples (n = 6). The error bars indicate mean ± standard deviation: *p < 0.05, **p < 0.01, ***p < 0.001, and ****p < 0.0001; ns: not significant (p > 0.05). The statistical analysis was performed using one-way analysis of variance with the Tukey multiple-comparisons test. i) 3D reconstruction (top) and extracted µ-CT images of the corresponding sections (bottom, indicated by the light blue areas) of harvested bone tissues after treated with different samples for 14 days.
2). Realising highly efficient sonodynamic bactericidal capability through the phonon–electron coupling effect using two‐dimensional catalytic planar defects. Advanced Materials, 2023 (PubMed: 36524686) [IF=29.4]
3). ETV2 regulating PHD2-HIF-1α axis controls metabolism reprogramming promotes vascularized bone regeneration. Bioactive Materials, 2024 [IF=18.9]
4). Osteoblastic and anti-osteoclastic activities of strontium-substituted silicocarnotite ceramics: In vitro and in vivo studies. Bioactive Materials, 2020 (PubMed: 32280833) [IF=18.9]
5). Spatiotemporal Characterization of Human Early Intervertebral Disc Formation at Single-Cell Resolution. Advanced Science, 2023 (PubMed: 36965031) [IF=15.1]

Application: IHC    Species: Human    Sample:

Figure 3 Characterization of matrisome clusters during early IVD formation. A) Representative IHC images of ACAN (upper lane) and COL1A1 (lower lane) in developing human IVDs at the indicated developmental stages. Arrows indicate the increased ECM in the human NP region. Scale bar, 100 µm. B) FPKM expression of the indicated signature genes in developing human NC/NP tissues captured by LCM during early IVD formation. N of 9, 10, 11, and 13 weeks = 4; N of 12 weeks = 3. C) Heatmap showing pairwise Pearson correlations of expressed matrisome genes in human developing NC/NP cells. D) The number of expressed genes associated with six matrisome patterns in the indicated human (upper) and mouse (lower) NC/NP cell subclusters. E) Representation analysis of GO categories showing different functions for TBXT+/T+ (left), CTSK+/Ctsk+ (middle), and KRT15+/Krt15+ clusters (right). Asterisks indicate the GO categories only enriched in human NC/NP subclusters. F) Violin plots showing the expression levels of representative genes associated with six matrisome patterns in the indicated human (left) and mouse (right) NC/NP cell subclusters. G) Representative IHC images of CTSK in human axial skeleton sections at the indicated developmental stages. The red arrow indicates the ECM in the NP region at the NPL stage. Scale bar, 200 µm. H) Representative images of lineage tracing in the Ctsk‐Cre;mT/mG mouse IVD. Scale bar, 200 µm. I) Dot plot showing the mean expression of selected mechanosensitive ion channel genes among seven human NC/NP cell subpopulations. The dot size indicates the percentage of cells in subclusters with detected expression.
6). Discovery of PRDM16-Mediated TRPA1 Induction as the Mechanism for Low Tubulo-Interstitial Fibrosis in Diabetic Kidney Disease. Advanced science (Weinheim, Baden-Wurttemberg, Germany), 2024 (PubMed: 38072665) [IF=15.1]

Application: WB    Species: Mouse    Sample:

Figure 4 TRPA1 inhibits expression of fibrotic proteins during HG‐incubation of BUMPT cells and in db/db diabetic mice. A,B) BUMPT cells were transfected with AAV2 carrying TRPA1 shRNA or negative control sequence (NC), and then treated with HG for 48 h to collect lysate for immunoblot analysis of indicated proteins. (A) Representative immunoblots. (B) Densitometry analysis of immunoblot bands. C,D) BUMPT cells were transfected with AAV2 vector or AAV2 carrying TRPA1 plasmid, and then treated with HG for 48 h to collect lysate for immunoblot analysis of indicated proteins. (C) Representative immunoblots. (D) Densitometry analysis of immunoblot bands. Quantitative data are expressed as mean ± SD (n = 6). # P < 0.05, versus scramble with NG group. * P < 0.05, versus scramble with HG group. E–K) Eight‐week‐old db/db diabetic mice were injected with AAV2 carrying shRNA or negative control sequence (NC) through vein tail for four weeks. (E) Representative immunoblots. (F) Densitometry analysis of immunoblot bands. (G) Immunohistochemical staining of collagen I&IV, fibronectin, and a‐SMA. (H‐K) Quantification of immunohistochemical staining of them. Original magnification x 400. Scale Bar:100 µm. Data are expressed as mean ± SD (n = 6). # P < 0.05, versus db/m/NC group. * P < 0.05, versus db/db/NC group. L–R) Eight‐week‐old db/db diabetic mice were injected with AAV2 carrying TRPA1 overexpression plasmid or AAV2 empty vector through vein tail for four weeks. (L) Representative immunoblots. (M) Densitometry analysis of immunoblot bands. (N) Immunohistochemical staining of collagen I&IV, fibronectin, and a‐SMA. (O‐R) Quantification of immunohistochemical staining of them. Original magnification x 400. Scale Bar:100 µm. Data are expressed as mean ± SD (n = 6). # P < 0.05, versus db/m/AAV‐Vector group. * P < 0.05, versus db/db/AAV‐Vector group.

Application: IHC    Species: Mouse    Sample:

Figure 4 TRPA1 inhibits expression of fibrotic proteins during HG‐incubation of BUMPT cells and in db/db diabetic mice. A,B) BUMPT cells were transfected with AAV2 carrying TRPA1 shRNA or negative control sequence (NC), and then treated with HG for 48 h to collect lysate for immunoblot analysis of indicated proteins. (A) Representative immunoblots. (B) Densitometry analysis of immunoblot bands. C,D) BUMPT cells were transfected with AAV2 vector or AAV2 carrying TRPA1 plasmid, and then treated with HG for 48 h to collect lysate for immunoblot analysis of indicated proteins. (C) Representative immunoblots. (D) Densitometry analysis of immunoblot bands. Quantitative data are expressed as mean ± SD (n = 6). # P < 0.05, versus scramble with NG group. * P < 0.05, versus scramble with HG group. E–K) Eight‐week‐old db/db diabetic mice were injected with AAV2 carrying shRNA or negative control sequence (NC) through vein tail for four weeks. (E) Representative immunoblots. (F) Densitometry analysis of immunoblot bands. (G) Immunohistochemical staining of collagen I&IV, fibronectin, and a‐SMA. (H‐K) Quantification of immunohistochemical staining of them. Original magnification x 400. Scale Bar:100 µm. Data are expressed as mean ± SD (n = 6). # P < 0.05, versus db/m/NC group. * P < 0.05, versus db/db/NC group. L–R) Eight‐week‐old db/db diabetic mice were injected with AAV2 carrying TRPA1 overexpression plasmid or AAV2 empty vector through vein tail for four weeks. (L) Representative immunoblots. (M) Densitometry analysis of immunoblot bands. (N) Immunohistochemical staining of collagen I&IV, fibronectin, and a‐SMA. (O‐R) Quantification of immunohistochemical staining of them. Original magnification x 400. Scale Bar:100 µm. Data are expressed as mean ± SD (n = 6). # P < 0.05, versus db/m/AAV‐Vector group. * P < 0.05, versus db/db/AAV‐Vector group.
7). Upregulation of BCL-2 by acridone derivative through gene promoter i-motif for alleviating liver damage of NAFLD/NASH. NUCLEIC ACIDS RESEARCH, 2020 (PubMed: 32710621) [IF=14.9]

Application: WB    Species: mouse    Sample: liver

Figure 7. Effect of A22 on ameliorating apoptosis, ER stress, inflammation, metabolic syndrome, and fibrogenesis in HF diet-fed mice. (A) Effect of A22 on BCL-2 gene transcription. (B) Effect of A22 on BAX gene transcription. (C) Effect of A22 on expressions of apoptosis-related proteins in liver. The extracted proteins from the liver were immunoblotted with specific antibodies, and quantified based on the loading control of ACTIN. (D) Effect of A22 on ER stress. The UPR proteins (IRE-1, PERK, elF-2 and CHOP) were analyzed by using western Blot. (E) Effect of A22 on expressions of inflammatory factors. (F) Effect of A22 on expressions of fibrogenic proteins.
8). LncRNA DACH1 protects against pulmonary fibrosis by binding to SRSF1 to suppress CTNNB1 accumulation. Acta Pharmaceutica Sinica B, 2022 (PubMed: 36176913) [IF=14.5]

Application: WB    Species: Mouse    Sample:

Figure 1 Loss of LncDACH1 results in pulmonary fibrosis in mice. (A) Micro-CT shows that the shadow area of the lungs in LncDACH1-KO mice was significantly greater than that of WT; n = 4. (B) Forced vital capacity (FVC), forced expiratory flow (FEF), FEV0.1, FEV0.1/FVC, inspiratory capacity (IC) as well as Flow-volume loops were reduced in LncDACH1-KO mice as detected by a flexiVent system; n = 4. (C) qRT-PCR validated that mRNA expression of Fn1, Col1a1, Col3a1 and Acta2 was promoted by LncDACH1 deficiency; n = 6. (D) The protein levels of FN1 and Collagen I detected by Western blot assays; n = 6. (E) Hydroxyproline content in LncDACH1-KO mice compared to WT mice; n = 6. (F, G) H&E and Masson staining reveal more exacerbated lung tissue morphology and increased fibrotic areas in LncDACH1-KO mice compared with WT mice; bar = 50 μm; n = 3. (H, I) Collagen I and α-SMA were increased in LncDACH1-KO mice as shown by immunohistochemical analysis; scale bar = 50 μm; n = 3. (J, K) Collagen I and α-SMA were stained by immunofluorescence analysis; bar = 50 μm; n = 3. Data are presented as mean ± SEM; ∗P < 0.05, ∗∗P < 0.01; ns, no significance. Micro-CT, micro computed tomography.
9). Gold nanoparticles targeting the autophagy–lysosome system to combat the inflammation-compromised osteogenic potential of periodontal ligament stem cells: From mechanism to therapy. Biomaterials, 2022 (PubMed: 36030103) [IF=14.0]
10). Fusion peptide engineered “statically-versatile” titanium implant simultaneously enhancing anti-infection, vascularization and osseointegration. Biomaterials, 2021 (PubMed: 33069134) [IF=14.0]
Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.