AP1S2 Antibody - #DF16115
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Adapter related protein complex 1 sigma 1B subunit; Adapter-related protein complex 1 sigma-1B subunit; Adaptor protein complex AP 1 sigma 1B subunit; Adaptor protein complex AP-1 sigma-1B subunit; Adaptor related protein complex 1 sigma 2 subunit; AP 1 complex subunit sigma 2; AP-1 complex subunit sigma-2; ap1s2; AP1S2_HUMAN; Clathrin adaptor complex AP1 sigma 1B subunit; Clathrin assembly protein complex 1 sigma 1B small chain; Clathrin assembly protein complex 1 sigma-1B small chain; Clathrin associated assembly adaptor protein small 1 like; DC22; Golgi adaptor HA1 AP1 adaptin sigma 1B subunit; Golgi adaptor HA1/AP1 adaptin sigma-1B subunit; mental retardation X linked 59; MGC:1902; MRX59; Sigma 1B subunit of AP 1 clathrin; Sigma 1B subunit of AP-1 clathrin; Sigma adaptin 1B; Sigma-adaptin 1B; Sigma1B adaptin; SIGMA1B; Sigma1B-adaptin;
Immunogens
A synthesized peptide derived from human AP1S2.
- P56377 AP1S2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
Research Backgrounds
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
Golgi apparatus. Cytoplasmic vesicle membrane>Peripheral membrane protein>Cytoplasmic side. Membrane>Clathrin-coated pit.
Note: Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.
Widely expressed.
Adaptor protein complex 1 (AP-1) is a heterotetramer composed of two large adaptins (gamma-type subunit AP1G1 and beta-type subunit AP1B1), a medium adaptin (mu-type subunit AP1M1 or AP1M2) and a small adaptin (sigma-type subunit AP1S1 or AP1S2 or AP1S3). Binds to MUC1.
Belongs to the adaptor complexes small subunit family.
Research Fields
· Cellular Processes > Transport and catabolism > Lysosome. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.