Product: AP1S2 Antibody
Catalog: DF16115
Description: Rabbit polyclonal antibody to AP1S2
Application: IHC IF/ICC
Reactivity: Human, Mouse
Mol.Wt.: 19kD(Calculated).
Uniprot: P56377

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
AP1S2 Antibody detects endogenous levels of AP1S2.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Adapter related protein complex 1 sigma 1B subunit; Adapter-related protein complex 1 sigma-1B subunit; Adaptor protein complex AP 1 sigma 1B subunit; Adaptor protein complex AP-1 sigma-1B subunit; Adaptor related protein complex 1 sigma 2 subunit; AP 1 complex subunit sigma 2; AP-1 complex subunit sigma-2; ap1s2; AP1S2_HUMAN; Clathrin adaptor complex AP1 sigma 1B subunit; Clathrin assembly protein complex 1 sigma 1B small chain; Clathrin assembly protein complex 1 sigma-1B small chain; Clathrin associated assembly adaptor protein small 1 like; DC22; Golgi adaptor HA1 AP1 adaptin sigma 1B subunit; Golgi adaptor HA1/AP1 adaptin sigma-1B subunit; mental retardation X linked 59; MGC:1902; MRX59; Sigma 1B subunit of AP 1 clathrin; Sigma 1B subunit of AP-1 clathrin; Sigma adaptin 1B; Sigma-adaptin 1B; Sigma1B adaptin; SIGMA1B; Sigma1B-adaptin;

Immunogens

Immunogen:

A synthesized peptide derived from human AP1S2.

Uniprot:
Gene(ID):
Expression:
P56377 AP1S2_HUMAN:

Widely expressed.

Sequence:
MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT

Research Backgrounds

Function:

Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.

Subcellular Location:

Golgi apparatus. Cytoplasmic vesicle membrane>Peripheral membrane protein>Cytoplasmic side. Membrane>Clathrin-coated pit.
Note: Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed.

Family&Domains:

Belongs to the adaptor complexes small subunit family.

Research Fields

· Cellular Processes > Transport and catabolism > Lysosome.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.