PRPS1L1 Antibody - #DF16106
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
phosphoribosyl pyrophosphate synthase 1 like 1; phosphoribosyl pyrophosphate synthase III; Phosphoribosyl pyrophosphate synthetase 1 like 1; Phosphoribosyl pyrophosphate synthetase III; Phosphoribosylpyrophosphate synthetase 1 like 1; Phosphoribosylpyrophosphate synthetase 3; phosphoribosylpyrophosphate synthetase subunit III; PRPS 1; PRPS 3; PRPS1; PRPS1 like 1; PRPS3; PRPSL; PRS III; PRSIII; ribose phosphate diphosphokinase catalytic chain III; Ribose phosphate pyrophosphokinase 3; Ribose phosphate pyrophosphokinase; Ribose phosphate pyrophosphokinase III;
Immunogens
A synthesized peptide derived from human PRPS1L1.
- P21108 PRPS3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIDESVRGEDVYIVQSGCGEINDSLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRSPISAKLVANMLSIAGADHIITMDLHASQIQGFFDIPVDNLYAEPTVLKWIRENIPEWKNCIIVSPDAGGAKRVTSIADQLNVDFALIHKERKKANEVDCIVLVGDVNDRVAILVDDMADTCVTICLAADKLLSAGATRVYAILTHGIFSGPAISRINTACFEAVVVTNTIPQDEKMKHCSKIRVIDISMILAEAIRRTHNGESVSYLFSHVPL
Research Backgrounds
Catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis.
Testis.
Homodimer. The active form is probably a hexamer composed of 3 homodimers (By similarity).
Belongs to the ribose-phosphate pyrophosphokinase family.
Research Fields
· Metabolism > Carbohydrate metabolism > Pentose phosphate pathway.
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Metabolism > Global and overview maps > Carbon metabolism.
· Metabolism > Global and overview maps > Biosynthesis of amino acids.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.