KIR3DL2 Antibody - #DF16073

(2)  
Product: KIR3DL2 Antibody
Catalog: DF16073
Description: Rabbit polyclonal antibody to KIR3DL2
Application: IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 50kD(Calculated).
Uniprot: P43630

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
KIR3DL2 Antibody detects endogenous levels of KIR3DL2.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CD158 antigen like family member K; CD158 antigen-like family member K; CD158k; KI3L2_HUMAN; Killer cell immunoglobulin like receptor 3DL2; killer cell immunoglobulin like receptor KIR3DL2; Killer cell immunoglobulin like receptor, three domains, long cytoplasmic tail, 2; Killer cell immunoglobulin-like receptor 3DL2; KIR antigen 3DL2; KIR3DL2; Kirl2; MHC class I NK cell receptor; Natural killer associated transcript 4; natural killer cell inhibitory receptor; Natural killer-associated transcript 4; NK associated transcript 4; NK associated transcript 4A, included; NK associated transcript 4B, included; NKAT-4; NKAT4; NKAT4B; p140; p70 natural killer cell receptor clone CL 5; p70 natural killer cell receptor clone CL-5; p70 NK receptor CL 5; p70 NK receptor CL-5;

Immunogens

Immunogen:

A synthesized peptide derived from human KIR3DL2.

Uniprot:

P43630(KI3L2_HUMAN) >>Visit HPA database.

Gene(ID):
KIR3DL2(3812)
Expression:
P43630 KI3L2_HUMAN:

Expressed in astrocytes.

Sequence:
MSLTVVSMACVGFFLLQGAWPLMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKISRPSQRPKTPLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF

Research Backgrounds

Function:

Receptor on natural killer (NK) cells and T cells for MHC class I molecules. Upon binding of peptide-free HLA-F open conformer, negatively regulates NK and T cell effector functions. Acts as a receptor on astrocytes for HLA-F. Through interaction with HLA-F, may protect motor neurons from astrocyte-induced toxicity.

Subcellular Location:

Cell membrane>Single-pass type I membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in astrocytes.

Subunit Structure:

Interacts with peptide-free HLA-F open conformer.

Family&Domains:

Belongs to the immunoglobulin superfamily.

Research Fields

· Human Diseases > Immune diseases > Graft-versus-host disease.

· Organismal Systems > Immune system > Antigen processing and presentation.   (View pathway)

· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.