FCF1 Antibody - #DF16072
Product: | FCF1 Antibody |
Catalog: | DF16072 |
Description: | Rabbit polyclonal antibody to FCF1 |
Application: | ELISA(peptide) |
Reactivity: | Human, Mouse |
Mol.Wt.: | 23kD(Calculated). |
Uniprot: | Q9Y324 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Bka; C14orf111; CGI 35; Fcf1; FCF1 small subunit (SSU) processome component homolog (S. cerevisiae); FCF1_HUMAN; rRNA processing protein FCF1 homolog; rRNA-processing protein FCF1 homolog;
Immunogens
A synthesized peptide derived from human FCF1.
- Q9Y324 FCF1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGKQKKTRKYATMKRMLSLRDQRLKEKDRLKPKKKEKKDPSALKEREVPQHPSCLFFQYNTQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAKCIPCITDCVMAEIEKLGQKYRVALRIAKDPRFERLPCTHKGTYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYISNHRYNIERMPDDYGAPRF
Research Backgrounds
Essential protein involved in pre-rRNA processing and 40S ribosomal subunit assembly.
Nucleus>Nucleolus.
Belongs to the UTP23/FCF1 family. FCF1 subfamily.
Research Fields
· Genetic Information Processing > Translation > Ribosome biogenesis in eukaryotes.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.