EXTL2 Antibody - #DF16070
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
4-N-acetylhexosaminyltransferase EXTL2; Alpha 1 4 N acetylhexosaminyltransferase EXTL2; Alpha GalNAcT EXTL2; Alpha-1; Alpha-GalNAcT EXTL2; Exostoses (multiple) like 2; Exostoses multiple like 2; Exostosin like 2; Exostosin like glycosyltransferase 2; EXT L2; EXT related protein 2; EXT-related protein 2; EXTL 2; EXTL2; EXTL2_HUMAN; EXTR 2; EXTR2; Glucuronyl galactosyl proteoglycan 4 alpha N acetylglucosaminyltransferase; Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase; Multiple exostoses like 2; Processed exostosin like 2; Processed exostosin-like 2;
Immunogens
A synthesized peptide derived from human EXTL2.
- Q9UBQ6 EXTL2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRCCHICKLPGRVMGIRVLRLSLVVILVLLLVAGALTALLPSVKEDKMLMLRREIKSQGKSTMDSFTLIMQTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEMQAPGSGNGDQYSMVLIGASFFNSKYLELFQRQPAAVHALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGMWHRAEHALQRSYCINKLVNIYDSMPLRYSNIMISQFGFPYANYKRKI
Research Backgrounds
Glycosyltransferase required for the biosynthesis of heparan-sulfate and responsible for the alternating addition of beta-1-4-linked glucuronic acid (GlcA) and alpha-1-4-linked N-acetylglucosamine (GlcNAc) units to nascent heparan sulfate chains.
The soluble form derives from the membrane form by proteolytic processing.
Endoplasmic reticulum membrane>Single-pass type II membrane protein.
Secreted.
Note: A soluble form is found in the serum.
Ubiquitous.
Belongs to the glycosyltransferase 47 family.
Research Fields
· Metabolism > Glycan biosynthesis and metabolism > Glycosaminoglycan biosynthesis - heparan sulfate / heparin.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.