CDIPT Antibody - #DF16061
| Product: | CDIPT Antibody |
| Catalog: | DF16061 |
| Description: | Rabbit polyclonal antibody to CDIPT |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 24kD(Calculated). |
| Uniprot: | O14735 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
CDP diacylglycerol inositol 3 phosphatidyltransferase (phosphatidylinositol synthase); CDP diacylglycerol inositol 3 phosphatidyltransferase; MGC1328; Phosphatidylinositol synthase; PIS; PIS1; PtdIns synthase;
Immunogens
A synthesized peptide derived from human CDIPT.
Detected in placenta (at protein level). Widely expressed. Higher expression in adult liver and skeletal muscle, slightly lower levels seen in pancreas, kidney, lung, placenta, brain, heart, leukocyte, colon, small intestine, ovary, testis, prostate, thymus and spleen. In fetus, expressed in kidney, liver, lung and brain.
- O14735 CDIPT_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKKK
Research Backgrounds
Catalyzes the biosynthesis of phosphatidylinositol (PtdIns) as well as PtdIns:inositol exchange reaction. May thus act to reduce an excessive cellular PtdIns content. The exchange activity is due to the reverse reaction of PtdIns synthase and is dependent on CMP, which is tightly bound to the enzyme.
Endoplasmic reticulum membrane>Multi-pass membrane protein. Golgi apparatus membrane>Multi-pass membrane protein. Cell membrane>Multi-pass membrane protein. Membrane.
Detected in placenta (at protein level). Widely expressed. Higher expression in adult liver and skeletal muscle, slightly lower levels seen in pancreas, kidney, lung, placenta, brain, heart, leukocyte, colon, small intestine, ovary, testis, prostate, thymus and spleen. In fetus, expressed in kidney, liver, lung and brain.
Belongs to the CDP-alcohol phosphatidyltransferase class-I family.
Research Fields
· Environmental Information Processing > Signal transduction > Phosphatidylinositol signaling system.
· Metabolism > Carbohydrate metabolism > Inositol phosphate metabolism.
· Metabolism > Lipid metabolism > Glycerophospholipid metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.