LRRC3B Antibody - #DF16048
![](/images/pubmed.gif)
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Leucine rich repeat containing 3B; Leucine-rich repeat protein LRP15; Leucine-rich repeat-containing protein 3B; LRC3B_HUMAN; LRRC3B; MGC102927;
Immunogens
A synthesized peptide derived from human LRRC3B.
- Q96PB8 LRC3B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISYVVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV
Research Backgrounds
Membrane>Single-pass membrane protein.
Belongs to the LRRC3 family.
References
Application: WB Species: Human Sample: B2B and Hs578T cell
Application: IF/ICC Species: Human Sample: lung cancer tissues
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.