OSCAR Antibody - #DF16040
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
hOSCAR; hOSCARM2; hOSCARM3; mOSCAR; Oscar; Oscar protein; OSCAR_HUMAN; OSCARS1; OSCARS2; Osteoclast associated immunoglobulin like receptor; Osteoclast associated receptor; Osteoclast-associated immunoglobulin-like receptor; Osteoclast-associated receptor; PIgR-3; PIGR3; Poly Ig receptor 3; Poly-Ig receptor 3; Polymeric immunoglobulin receptor 3;
Immunogens
A synthesized peptide derived from human OSCAR.
- Q8IYS5 OSCAR_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MALVLILQLLTLWPLCHTDITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQPLLPQTQDSWDPAPPPSDPGV
Research Backgrounds
Regulator of osteoclastogenesis which plays an important bone-specific function in osteoclast differentiation.
Secreted.
Cell membrane>Single-pass type I membrane protein.
Belongs to the leukocyte receptor complex/polymeric immunogobulin receptor (PIR/LRC) family.
Research Fields
· Organismal Systems > Development > Osteoclast differentiation. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.