TM4SF4 Antibody - #DF15884
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
FLJ31015; il TMP; ILTMP; Intestinal and liver (il) tetraspan membrane protein; Intestine and liver tetraspan membrane protein; Lrtm4; MGC19127; Transmembrane 4 L six family member 4; transmembrane 4 L6 family member 4; Transmembrane 4 superfamily member 4;
Immunogens
A synthesized peptide derived from human TM4SF4.
- P48230 T4S4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MCTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGGILGSGVLMIFPALVFLGLKNNDCCGCCGNEGCGKRFAMFTSTIFAVVGFLGAGYSFIISAISINKGPKCLMANSTWGYPFHDGDYLNDEALWNKCREPLNVVPWNLTLFSILLVVGGIQMVLCAIQVVNGLLGTLCGDCQCCGCCGGDGPV
Research Backgrounds
Regulates the adhesive and proliferative status of intestinal epithelial cells. Can mediate density-dependent cell proliferation.
N-glycosylated. Glycosylation is required for the growth inhibitory effect.
Membrane>Multi-pass membrane protein.
Jejunum and liver.
Belongs to the L6 tetraspanin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.