MOGAT1 Antibody - #DF15824
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
0610030A14Rik; 1110064N14Rik; 2-acylglycerol O-acyltransferase 1; Acyl CoA:monoacylglycerol acyltransferase 1; Acyl-CoA:monoacylglycerol acyltransferase 1; DGAT2L; DGAT2L1; Diacylglycerol acyltransferase 2 like; Diacylglycerol acyltransferase 2-like protein 1; Diacylglycerol O acyltransferase 2 like 1; Diacylglycerol O-acyltransferase candidate 2; hDC2; mDC2; MGAT1; MGC118035; MOGAT1; MOGT1; MOGT1_HUMAN; Monoacylglycerol O acyltransferase 1; Monoacylglycerol O-acyltransferase 1; OTTMUSP00000025181;
Immunogens
A synthesized peptide derived from human MOGAT1.
- Q96PD6 MOGT1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKVEFAPLNIQLARRLQTVAVLQWVLKYLLLGPMSIGITVMLIIHNYLFLYIPYLMWLYFDWHTPERGGRRSSWIKNWTLWKHFKDYFPIHLIKTQDLDPSHNYIFGFHPHGIMAVGAFGNFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGNISVIVLGGAKESLDAHPGKFTLFIRQRKGFVKIALTHGASLVPVVSFGENELFKQTDNPEGSWIRTVQNKLQKIMGFALPLFHARGVFQYNFGLMTYRKAIHTVVGRPIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK
Research Backgrounds
Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Probably not involved in absorption of dietary fat in the small intestine (By similarity).
Endoplasmic reticulum membrane>Multi-pass membrane protein.
Belongs to the diacylglycerol acyltransferase family.
Research Fields
· Metabolism > Lipid metabolism > Glycerolipid metabolism.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.