MPV17L2 Antibody - #DF15815
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
FKSG 24; MGC110861; MGC12972; MPV17 mitochondrial membrane protein like 2; MPV17L2; Uncharacterized protein FKSG24;
Immunogens
A synthesized peptide derived from human MPV17L2.
- Q567V2 M17L2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARGGWRRLRRLLSAGQLLFQGRALLVTNTLGCGALMAAGDGVRQSWEIRARPGQVFDPRRSASMFAVGCSMGPFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLGLGCLEGQTVGESCQELREKFWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYLKYRSPVPLTPPGCVALDTRAD
Research Backgrounds
Required for the assembly and stability of the mitochondrial ribosome. Is a positive regulator of mitochondrial protein synthesis.
Membrane>Multi-pass membrane protein. Mitochondrion inner membrane.
Interacts with the large mitochondrial ribosomal subunit.
Belongs to the peroxisomal membrane protein PXMP2/4 family.
Research Fields
· Cellular Processes > Transport and catabolism > Peroxisome. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.