PMVK Antibody - #DF15683
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
hPMK; HUMPMKI; OTTHUMP00000035546; Phosphomevalonate kinase; PMK; PMK PEN; PMKA; PMKase; PMKI; PMKPEN; PMVK; PMVK_HUMAN;
Immunogens
A synthesized peptide derived from human PMVK.
Heart, liver, skeletal muscle, kidney, and pancreas. Lower level in brain, placenta and lung.
- Q15126 PMVK_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL
Research Backgrounds
Cytoplasm>Cytosol.
Heart, liver, skeletal muscle, kidney, and pancreas. Lower level in brain, placenta and lung.
Monomer.
Research Fields
· Cellular Processes > Transport and catabolism > Peroxisome. (View pathway)
· Metabolism > Metabolism of terpenoids and polyketides > Terpenoid backbone biosynthesis.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.