NXF5 Antibody - #DF15642
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Nuclear RNA export factor 5; TAP like protein 1; TAPL 1; TAPL1;
Immunogens
A synthesized peptide derived from human NXF5.
- Q9H1B4 NXF5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRRNTQDENMRKWFKVTIPYGIKYDKAWLMNSIQSNCSVPFTPVDFHYIRNRACFFVQVASAASALKDVSYKIYDDENQKICIFVSHFTAPYSVKNKLKPGQMEMLKLTMNKRYNVSQQALDLQNLRFDPDLMGRDIDIILNRRNCMAATLKITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFPKLLRLDGRELSAPVIVDIDSSETMKPCKENFTGSETLKHLVLQFLQQSNLCKYFKDSRNIKILKDPYLQRKLLKHTKCPRNVDSLSALPETQHDFTSILVDMWYQTVNTCFLPRAGPESQRWWCLLSLKWKDGLRVLILPSCGPSSLPLAAIPVCAS
Research Backgrounds
Could be involved in the export of mRNA from the nucleus to the cytoplasm. Could also have a role in polarized cytoplasmic transport and localization of mRNA in neurons.
Cytoplasm. Nucleus.
Note: Mainly localized in the cytoplasm of cells and more particularly in the cell body and neurites of hippocampal neurons. Although nuclear localization is also observed. Not detected at nuclear rim.
Interacts with NXT1 and NXT2.
The NTF2 domain heterodimerizes with NXT1 and NXT2.
The RNA-binding domain is a non-canonical RNP-type domain.
Belongs to the NXF family.
Research Fields
· Genetic Information Processing > Translation > Ribosome biogenesis in eukaryotes.
· Genetic Information Processing > Translation > RNA transport.
· Genetic Information Processing > Translation > mRNA surveillance pathway.
· Human Diseases > Infectious diseases: Viral > Influenza A.
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.