PENK Antibody - #DF15623
![](/images/pubmed.gif)
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Leu-enkephalin; Met-enkephalin; Met-enkephalin-Arg-Gly-Leu; Met-enkephalin-Arg-Phe; Methionine enkephalin; OGF; Opioid growth factor; PENK; PENK(114-133); PENK(143-183); PENK(237-258); PENK_HUMAN; PPA; Proenkephalin A; Proenkephalin; Proenkephalin-A; Synenkephalin;
Immunogens
A synthesized peptide derived from human PENK.
- P01210 PENK_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF
Research Backgrounds
Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress. PENK(114-133) and PENK(237-258) increase glutamate release in the striatum. PENK(114-133) decreases GABA concentration in the striatum.
The N-terminal domain contains 6 conserved cysteines thought to be involved in disulfide bonding and/or processing.
Secreted.
Belongs to the opioid neuropeptide precursor family.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.