GUCA1C Antibody - #DF15602
Product: | GUCA1C Antibody |
Catalog: | DF15602 |
Description: | Rabbit polyclonal antibody to GUCA1C |
Application: | ELISA(peptide) |
Reactivity: | Human |
Mol.Wt.: | 24kD(Calculated). |
Uniprot: | O95843 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
GCAP 3; Guanylate cyclase activating photoreceptor 3; Guanylate cyclase activator 1C; Guanylyl cyclase activating protein 3; Guanylyl cyclase-activating protein 3; GUC1C_HUMAN; GUCA1C;
Immunogens
A synthesized peptide derived from human GUCA1C.
- O95843 GUC1C_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFVDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLRVICNGKQPDMETDSSKSPDKAGLGKVKMK
Research Backgrounds
Stimulates guanylyl cyclase 1 (GC1) and GC2 when free calcium ions concentration is low and inhibits guanylyl cyclases when free calcium ions concentration is elevated. This Ca(2+)-sensitive regulation of guanylyl cyclase (GC) is a key event in recovery of the dark state of rod photoreceptors following light exposure.
Retina.
Binds three calcium ions (via EF-hand 2, 3 and 4).
Research Fields
· Organismal Systems > Sensory system > Phototransduction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.