ZMPSTE24 Antibody - #DF15601
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
CAAX prenyl protease 1 homolog; FACE-1; FACE1; FACE1_HUMAN; Farnesylated proteins converting enzyme 1; Farnesylated proteins-converting enzyme 1; Prenyl protein specific endoprotease 1; Prenyl protein-specific endoprotease 1; STE24; Zinc metalloproteinase Ste24 homolog; zmpste24;
Immunogens
A synthesized peptide derived from human ZMPSTE24.
- O75844 FACE1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGMWASLDALWEMPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWSGLYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPWSLYNTFVIEEKHGFNQQTLGFFMKDAIKKFVVTQCILLPVSSLLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQEDSGMEPRNEEEGNSEEIKAKVKNKKQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQALKTMKQH
Research Backgrounds
Proteolytically removes the C-terminal three residues of farnesylated proteins. Acts on lamin A/C.
Endoplasmic reticulum membrane>Multi-pass membrane protein. Nucleus inner membrane>Multi-pass membrane protein.
Widely expressed. High levels in kidney, prostate, testis and ovary.
The metalloprotease domain is constituted by the two C-terminal nuclear regions.
Belongs to the peptidase M48A family.
Research Fields
· Metabolism > Metabolism of terpenoids and polyketides > Terpenoid backbone biosynthesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.