TMBIM6 Antibody - #DF15555
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Bax inhibitor 1; BI 1; BI-1; BI1; BI1_HUMAN; TEGT; testis enhanced gene transcript (BAX inhibitor 1); Testis enhanced gene transcript; Testis-enhanced gene transcript protein; TMBIM 6; TMBIM6; Transmembrane BAX inhibitor motif containing 6; Transmembrane BAX inhibitor motif containing protein 6; Transmembrane BAX inhibitor motif-containing protein 6;
Immunogens
A synthesized peptide derived from human TMBIM6.
- P55061 BI1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMILAMNEKDKKKEKK
Research Backgrounds
Suppressor of apoptosis. Modulates unfolded protein response signaling. Modulates ER calcium homeostasis by acting as a calcium-leak channel. Negatively regulates autophagy and autophagosome formation, especially during periods of nutrient deprivation, and reduces cell survival during starvation (By similarity).
Endoplasmic reticulum membrane>Multi-pass membrane protein.
Highly abundant in testis.
Interacts with BCL2 and BCL2L1.
The intra-membrane loop at the C-terminus acts as a calcium pore, mediating calcium leak from the ER into the cytosol.
Belongs to the BI1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.