Product: UGP2 Antibody
Catalog: DF15541
Description: Rabbit polyclonal antibody to UGP2
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 57kD(Calculated).
Uniprot: Q16851

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Polyclonal
Specificity:
UGP2 Antibody detects endogenous levels of UGP2.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

pHC379; UDP glucose diphosphorylase; UDP glucose pyrophosphorylase 1; UDP glucose pyrophosphorylase 2; UDP glucose pyrophosphorylase; UDP-glucose pyrophosphorylase; UDPG; UDPGP 2; UDPGP; UDPGP2; UGP 1; UGP 2; UGP1; Ugp2; UGPA_HUMAN; UGPase 2; UGPase; UGPP 1; UGPP 2; UGPP1; UGPP2; Uridyl diphosphate glucose pyrophosphorylase 1; Uridyl diphosphate glucose pyrophosphorylase 2; UTP glucose 1 phosphate uridyltransferase; UTP glucose 1 phosphate uridylyltransferase 2; UTP glucose 1 phosphate uridylyltransferase; UTP--glucose-1-phosphate uridylyltransferase;

Immunogens

Immunogen:

A synthesized peptide derived from human UGP2.

Uniprot:
Gene(ID):
Sequence:
MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH

Research Backgrounds

Function:

Plays a central role as a glucosyl donor in cellular metabolic pathways.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the UDPGP type 1 family.

Research Fields

· Metabolism > Carbohydrate metabolism > Pentose and glucuronate interconversions.

· Metabolism > Carbohydrate metabolism > Galactose metabolism.

· Metabolism > Carbohydrate metabolism > Starch and sucrose metabolism.

· Metabolism > Carbohydrate metabolism > Amino sugar and nucleotide sugar metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.