UGP2 Antibody - #DF15541
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
pHC379; UDP glucose diphosphorylase; UDP glucose pyrophosphorylase 1; UDP glucose pyrophosphorylase 2; UDP glucose pyrophosphorylase; UDP-glucose pyrophosphorylase; UDPG; UDPGP 2; UDPGP; UDPGP2; UGP 1; UGP 2; UGP1; Ugp2; UGPA_HUMAN; UGPase 2; UGPase; UGPP 1; UGPP 2; UGPP1; UGPP2; Uridyl diphosphate glucose pyrophosphorylase 1; Uridyl diphosphate glucose pyrophosphorylase 2; UTP glucose 1 phosphate uridyltransferase; UTP glucose 1 phosphate uridylyltransferase 2; UTP glucose 1 phosphate uridylyltransferase; UTP--glucose-1-phosphate uridylyltransferase;
Immunogens
A synthesized peptide derived from human UGP2.
- Q16851 UGPA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH
Research Backgrounds
Plays a central role as a glucosyl donor in cellular metabolic pathways.
Cytoplasm.
Homooctamer.
Belongs to the UDPGP type 1 family.
Research Fields
· Metabolism > Carbohydrate metabolism > Pentose and glucuronate interconversions.
· Metabolism > Carbohydrate metabolism > Galactose metabolism.
· Metabolism > Carbohydrate metabolism > Starch and sucrose metabolism.
· Metabolism > Carbohydrate metabolism > Amino sugar and nucleotide sugar metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.