UBE2G2 Antibody - #DF15540
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Human ubiquitin conjugating enzyme G29; UB2G2_HUMAN; UBC 7; UBC7; UBC7 homolog yeast; UBE2G2; Ubiquitin carrier protein G2; Ubiquitin conjugating enzyme 7; Ubiquitin conjugating enzyme E2 G2; Ubiquitin conjugating enzyme E2G 2 (homologous to yeast UBC7); Ubiquitin conjugating enzyme E2G 2 (UBC7 homolog yeast); Ubiquitin conjugating enzyme E2G 2 (UBC7 homolog, yeast); Ubiquitin conjugating enzyme E2G 2; Ubiquitin conjugating enzyme G2; Ubiquitin protein ligase G2; Ubiquitin-conjugating enzyme E2 G2; Ubiquitin-protein ligase G2;
Immunogens
A synthesized peptide derived from human UBE2G2.
- P60604 UB2G2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL
Research Backgrounds
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Involved in endoplasmic reticulum-associated degradation (ERAD).
Belongs to the ubiquitin-conjugating enzyme family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)
· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum. (View pathway)
· Human Diseases > Neurodegenerative diseases > Parkinson's disease.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.