IMP3 Antibody - #DF15488
| Product: | IMP3 Antibody |
| Catalog: | DF15488 |
| Description: | Rabbit polyclonal antibody to IMP3 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 22kD(Calculated). |
| Uniprot: | Q9NV31 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
BRMS2; C15orf12; Chromosome 15 open reading frame 12; DKFZp586L0118; FLJ10968; imp3; IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast); IMP3_HUMAN; Mitochondrial ribosomal protein S4; MRPS4; OTTHUMP00000183524; U3 small nucleolar ribonucleoprotein protein imp3; U3 snoRNP protein 3 homolog; U3 snoRNP protein imp3;
Immunogens
A synthesized peptide derived from human IMP3.
- Q9NV31 IMP3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA
Research Backgrounds
Component of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP). Required for the early cleavages during pre-18S ribosomal RNA processing.
Nucleus>Nucleolus.
Belongs to the universal ribosomal protein uS4 family.
Research Fields
· Genetic Information Processing > Translation > Ribosome biogenesis in eukaryotes.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.