FUNDC1 antibody - #DF15481
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
FUN14 domain containing 1; FUN14 domain containing protein 1; FUN14 domain-containing protein 1; FUND1_HUMAN; fundc1;
Immunogens
A synthesized peptide derived from human FUNDC1.
- Q8IVP5 FUND1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS
PTMs - Q8IVP5 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y11 | Phosphorylation | Uniprot | |
S13 | Phosphorylation | Uniprot | |
S17 | Phosphorylation | Uniprot | |
Y18 | Phosphorylation | Uniprot | |
S40 | Phosphorylation | Uniprot | |
S41 | Phosphorylation | Uniprot | |
K119 | Ubiquitination | Uniprot |
Research Backgrounds
Acts as an activator of hypoxia-induced mitophagy, an important mechanism for mitochondrial quality control.
Phosphorylation at Tyr-18 by SRC inhibits activation of mitophagy. Following hypoxia, dephosphorylated at Tyr-18, leading to interaction with MAP1 LC3 family proteins and triggering mitophagy.
Mitochondrion outer membrane>Multi-pass membrane protein.
Widely expressed.
Interacts (via YXXL motif) with MAP1 LC3 family proteins MAP1LC3A, MAP1LC3B and GABARAP.
The YXXL motif mediates the interaction with MAP1 LC3 family proteins MAP1LC3A, MAP1LC3B and GABARAP.
Belongs to the FUN14 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.