RPS19BP1 Antibody - #DF15462
Product: | RPS19BP1 Antibody |
Catalog: | DF15462 |
Description: | Rabbit polyclonal antibody to RPS19BP1 |
Application: | ELISA(peptide) |
Reactivity: | Human |
Mol.Wt.: | 15kD(Calculated). |
Uniprot: | Q86WX3 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
40S ribosomal protein S19 binding protein 1; 40S ribosomal protein S19-binding protein 1; Active regulator of SIRT1; AROS; AROS_HUMAN; Homolog of mouse S19 binding protein; Ribosomal protein S19 binding protein 1; RPS19 binding protein 1; RPS19-binding protein 1; RPS19BP1; S19BP;
Immunogens
A synthesized peptide derived from human RPS19BP1.
- Q86WX3 AROS_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS
Research Backgrounds
Direct regulator of SIRT1. Enhances SIRT1-mediated deacetylation of p53/TP53, thereby participating in inhibition of p53/TP53-mediated transcriptional activity.
Citrullinated by PADI4.
Nucleus>Nucleolus.
Widely expressed (at protein level).
Interacts with RPS19 (By similarity). Interacts with SIRT1.
Belongs to the AROS family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.