IL3RA Antibody - #DF15460
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
CD123; CD123 antigen; hIL 3Ra; hIL-3Ra; hIL3Ra; IL 3 receptor alpha SP2 isoform; IL 3R alpha; IL-3 receptor subunit alpha; IL-3R subunit alpha; IL-3R-alpha; IL-3RA; IL3 Receptor alpha; IL3R; Il3ra; IL3RA_HUMAN; IL3RAX; IL3RAY; IL3RX; IL3RY; Interleukin 3 receptor alpha chain; Interleukin 3 receptor, alpha (low affinity); Interleukin 3 receptor, alpha; Interleukin-3 Receptor alpha; Interleukin-3 receptor subunit alpha; Interleukin3 receptor; Interleukin3 receptor, Y-chromosomal;
Immunogens
A synthesized peptide derived from human IL3RA.
- P26951 IL3RA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Research Backgrounds
This is a receptor for interleukin-3.
Membrane>Single-pass type I membrane protein.
Heterodimer of an alpha and a beta subunit. The beta subunit is common to the IL3, IL5 and GM-CSF receptors.
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation.
Belongs to the type I cytokine receptor family. Type 5 subfamily.
Research Fields
· Cellular Processes > Cell growth and death > Apoptosis. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Organismal Systems > Immune system > Hematopoietic cell lineage. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.