Product: CERS1 Antibody
Catalog: DF15450
Description: Rabbit polyclonal antibody to CERS1
Application: WB IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 40kD(Calculated).
Uniprot: P27544

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
CERS1 Antibody detects endogenous levels of CERS1.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Ceramide synthase 1; CerS1; CERS1_HUMAN; LAG1; LAG1 homolog ceramide synthase 1; LAG1 longevity assurance homolog 1; LASS 1; LASS1; Longevity assurance (LAG1 S. cerevisiae) homolog 1; Longevity assurance gene 1; Longevity assurance gene 1 protein homolog 1; MGC90349; Protein LAG1; Protein UOG 1; Protein UOG-1; UOG 1 protein; UOG1; Upstream of GDF1;

Immunogens

Immunogen:

A synthesized peptide derived from human CERS1.

Uniprot:
Gene(ID):
Sequence:
MAAAGPAAGPTGPEPMPSYAQLVQRGWGSALAAARGCTDCGWGLARRGLAEHAHLAPPELLLLALGALGWTALRSAATARLFRPLAKRCCLQPRDAAKMPESAWKFLFYLGSWSYSAYLLFGTDYPFFHDPPSVFYDWTPGMAVPRDIAAAYLLQGSFYGHSIYATLYMDTWRKDSVVMLLHHVVTLILIVSSYAFRYHNVGILVLFLHDISDVQLEFTKLNIYFKSRGGSYHRLHALAADLGCLSFGFSWFWFRLYWFPLKVLYATSHCSLRTVPDIPFYFFFNALLLLLTLMNLYWFLYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF

Research Backgrounds

Function:

Ceramide synthase that catalyzes formation of ceramide from sphinganine and acyl-CoA substrates, with high selectivity toward stearoyl-CoA (octadecanoyl-CoA; C18:0-CoA).

PTMs:

Acetylated. Deacetylation by SIRT3 increases enzyme activity and promotes mitochondrial ceramide accumulation.

Subcellular Location:

Endoplasmic reticulum membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location

Research Fields

· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway.   (View pathway)

· Metabolism > Lipid metabolism > Sphingolipid metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

References

1). Exercise improves depressive-like behavior in adolescent mice by regulating sphingosine and ceramide metabolism through microglial CerS1. Communications biology, 2025 (PubMed: 40537488) [IF=5.9]

Application: WB    Species: Mouse    Sample:

Fig. 3: CerS1 is upregulated in microglia of HIIT and MICT mice. A An experimental protocol for FACS and a gate strategy for CD11b+CD45Low microglia were presented. B, C Heat map of differentially expressed genes in microglia after HIIT and MICT. D, E KEGG analysis of the differentially expressed genes in HIIT and MICT. F CerS1 mRNA levels in microglia by QPCR analysis (N  = 3 per group, one-way ANOVA, F (3, 12) = 89.70). G Representative western blot images showing the protein level of CerS1 (N  = 3 per group, two-sided Student’s t tests, T (4) = 4.948). The mock treatment was a blank control with PBS added. Data are shown as the mean ± s.d. P  

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.