SDHD Antibody - #DF15424

(2)  
Product: SDHD Antibody
Catalog: DF15424
Description: Rabbit polyclonal antibody to SDHD
Application: IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 17kD(Calculated).
Uniprot: O14521

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
SDHD Antibody detects endogenous levels of SDHD.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CBT1; CII 4; CII-4; CII4; CWS3; CybS; DHSD_HUMAN; mitochondrial; OTTHUMP00000234720; OTTHUMP00000234721; OTTHUMP00000234722; OTTHUMP00000234723; OTTHUMP00000234724; OTTHUMP00000234725; OTTHUMP00000234726; PGL; PGL1; QPs3; SDH4; sdhD; Succinate dehydrogenase [ubiquinone] cytochrome b small subunit; Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial; Succinate dehydrogenase complex subunit D; Succinate dehydrogenase complex, subunit D, integral membrane protein; Succinate dehydrogenase ubiquinone cytochrome B small subunit; Succinate ubiquinone oxidoreductase cytochrome b small subunit; Succinate ubiquinone reductase membrane anchor subunit; Succinate-ubiquinone oxidoreductase cytochrome b small subunit; Succinate-ubiquinone reductase membrane anchor subunit;

Immunogens

Immunogen:

A synthesized peptide derived from human SDHD.

Uniprot:

O14521(DHSD_HUMAN) >>Visit HPA database.

Gene(ID):
SDHD(6392)
Sequence:
MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDALQKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL

Research Backgrounds

Function:

Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).

Subcellular Location:

Mitochondrion inner membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Component of complex II composed of four subunits: the flavoprotein (FP) SDHA, iron-sulfur protein (IP) SDHB, and a cytochrome b560 composed of SDHC and SDHD.

Family&Domains:

Belongs to the CybS family.

Research Fields

· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).

· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.

· Human Diseases > Neurodegenerative diseases > Parkinson's disease.

· Human Diseases > Neurodegenerative diseases > Huntington's disease.

· Metabolism > Carbohydrate metabolism > Citrate cycle (TCA cycle).

· Metabolism > Energy metabolism > Oxidative phosphorylation.

· Metabolism > Global and overview maps > Metabolic pathways.

· Metabolism > Global and overview maps > Carbon metabolism.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.