BBOX1 Antibody - #DF15421
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
2-oxoglutarate dioxygenase; BBH; BBOX 1; BBOX; Bbox1; BODG_HUMAN; Butyrobetaine (gamma) 2 oxoglutarate dioxygenase (gamma butyrobetaine hydroxylase) 1; G BBH; Gamma BBH; Gamma butyrobetaine 2 oxoglutarate dioxygenase 1; Gamma butyrobetaine dioxygenase; Gamma butyrobetaine hydroxylase; Gamma-BBH; Gamma-butyrobetaine; Gamma-butyrobetaine dioxygenase; Gamma-butyrobetaine hydroxylase;
Immunogens
A synthesized peptide derived from human BBOX1.
Highly expressed in kidney; moderately expressed in liver; very low expression in brain.
- O75936 BODG_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDVNIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGN
Research Backgrounds
Catalyzes the formation of L-carnitine from gamma-butyrobetaine.
Cytoplasm.
Highly expressed in kidney; moderately expressed in liver; very low expression in brain.
Belongs to the gamma-BBH/TMLD family.
Research Fields
· Metabolism > Amino acid metabolism > Lysine degradation.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.