SBDS Antibody - #DF15344
Product: | SBDS Antibody |
Catalog: | DF15344 |
Description: | Rabbit polyclonal antibody to SBDS |
Application: | ELISA(peptide) |
Reactivity: | Human, Mouse |
Mol.Wt.: | 29kD(Calculated). |
Uniprot: | Q9Y3A5 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
4733401P19Rik; AI836084; CGI 97; CGI-97; FLJ10917; MGC105922; Protein 22A3; Ribosome maturation protein SBDS; sbds; SBDS_HUMAN; SDS; Shwachman Bodian Diamond syndrome protein; Shwachman Bodian Diamond syndrome protein homolog; Shwachman Bodian-Diamond syndrome; Shwachman-Bodian-Diamond syndrome protein; SWDS;
Immunogens
A synthesized peptide derived from human SBDS.
- Q9Y3A5 SBDS_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
Research Backgrounds
Required for the assembly of mature ribosomes and ribosome biogenesis. Together with EFL1, triggers the GTP-dependent release of EIF6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence by allowing 80S ribosome assembly and facilitating EIF6 recycling to the nucleus, where it is required for 60S rRNA processing and nuclear export. Required for normal levels of protein synthesis. May play a role in cellular stress resistance. May play a role in cellular response to DNA damage. May play a role in cell proliferation.
Cytoplasm. Nucleus>Nucleolus. Nucleus>Nucleoplasm. Cytoplasm>Cytoskeleton>Spindle.
Note: Primarily detected in the cytoplasm, and at low levels in nucleus and nucleolus (PubMed:19602484 and PubMed:17475909). Detected in the nucleolus during G1 and G2 phase of the cell cycle, and diffusely distributed in the nucleus during S phase. Detected at the mitotic spindle. Colocalizes with the microtubule organizing center during interphase (PubMed:19759903).
Widely expressed.
Associates with the 60S ribosomal subunit. Interacts with NPM1, RPA1 and PRKDC. May interact with NIP7. Found in a complex consisting of the 60S ribosomal subunit, SBDS and EFL1. Interacts with EFL1.
Belongs to the SDO1/SBDS family.
Research Fields
· Genetic Information Processing > Translation > Ribosome biogenesis in eukaryotes.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.