Rel Antibody - #AF6395
Product: | Rel Antibody |
Catalog: | AF6395 |
Description: | Rabbit polyclonal antibody to Rel |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 78kDa; 69kD(Calculated). |
Uniprot: | Q04864 |
RRID: | AB_2835230 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF6395, RRID:AB_2835230.
Fold/Unfold
Avian reticuloendotheliosis; C REL; C Rel protein; c Rel proto oncogene protein; Oncogene REL; Oncogene REL avian reticuloendotheliosis; Proto-oncogene c-Rel; REL; REL_HUMAN; v rel avian reticuloendotheliosis viral oncogene homolog; v rel reticuloendotheliosis viral oncogene homolog; V rel reticuloendotheliosis viral oncogene homolog (avian);
Immunogens
- Q04864 REL_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQV
PTMs - Q04864 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
A2 | Acetylation | Uniprot | |
S3 | Phosphorylation | Uniprot | |
Y6 | Phosphorylation | Uniprot | |
K26 | Sumoylation | Uniprot | |
S34 | Phosphorylation | Uniprot | |
Y47 | Phosphorylation | Uniprot | |
K82 | Ubiquitination | Uniprot | |
Y88 | Phosphorylation | Uniprot | |
Y89 | Phosphorylation | Uniprot | |
Y176 | Phosphorylation | Uniprot | |
K210 | Ubiquitination | Uniprot | |
S386 | Phosphorylation | Uniprot | |
Y387 | Phosphorylation | Uniprot | |
R421 | Methylation | Uniprot | |
T433 | Phosphorylation | Uniprot | |
T435 | Phosphorylation | Uniprot | |
S492 | Phosphorylation | Uniprot | |
S503 | Phosphorylation | Uniprot | |
S516 | Phosphorylation | Uniprot | |
S523 | Phosphorylation | Uniprot | |
S526 | Phosphorylation | Uniprot | |
S557 | Phosphorylation | O14920 (IKBKB) , O15111 (CHUK) | Uniprot |
Y597 | Phosphorylation | Uniprot |
Research Backgrounds
Proto-oncogene that may play a role in differentiation and lymphopoiesis. NF-kappa-B is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. The NF-kappa-B heterodimer RELA/p65-c-Rel is a transcriptional activator.
Nucleus.
Component of the NF-kappa-B p65-c-Rel complex. Component of the NF-kappa-B p50-c-Rel complex. Component of the NF-kappa-B p52-c-Rel complex. Homodimer; component of the NF-kappa-B c-Rel-c-Rel complex (By similarity). Interacts with NKIRAS1. Interacts with NFKBIB (By similarity). Interacts with NFKBIE.
Research Fields
· Environmental Information Processing > Signal transduction > Ras signaling pathway. (View pathway)
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.