TOMM5 Antibody - #DF15313
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
1110019J04Rik; C9orf105; Mitochondrial import receptor subunit TOM5 homolog; Mitochondrial outer membrane protein TOM5; RP11-263I4.1; RP11-613M10.3; TOM5; TOMM5; Translocase of outer mitochondrial membrane 5 homolog (yeast);
Immunogens
A synthesized peptide derived from human TOMM5.
- Q8N4H5 TOM5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI
Research Backgrounds
Mitochondrion outer membrane>Single-pass membrane protein.
Forms part of the preprotein translocase complex of the outer mitochondrial membrane (TOM complex) which consists of at least 7 different proteins (TOMM5, TOMM6, TOMM7, TOMM20, TOMM22, TOMM40 and TOMM70).
Belongs to the Tom5 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.