Product: Caveolin 1 Antibody
Catalog: AF6386
Description: Rabbit polyclonal antibody to Caveolin 1
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 23kDa; 20kD(Calculated).
Uniprot: Q03135
RRID: AB_2835227

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
Caveolin 1 Antibody detects endogenous levels of total Caveolin 1.
RRID:
AB_2835227
Cite Format: Affinity Biosciences Cat# AF6386, RRID:AB_2835227.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

BSCL3; CAV; CAV1; CAV1_HUMAN; caveolae protein, 22 kD; caveolin 1 alpha isoform; caveolin 1 beta isoform; Caveolin 1 caveolae protein 22kDa; Caveolin-1; Caveolin1; cell growth-inhibiting protein 32; CGL3; LCCNS; MSTP085; OTTHUMP00000025031; PPH3; VIP 21; VIP21;

Immunogens

Immunogen:

A synthesized peptide derived from human Caveolin 1, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
Q03135 CAV1_HUMAN:

Skeletal muscle, liver, stomach, lung, kidney and heart (at protein level). Expressed in the brain.

Description:
caveolin-1 May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Involved in the costimulatory signal essential for T-cell receptor (TCR)- mediated T-cell activation.
Sequence:
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Chicken
64
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

May act as a scaffolding protein within caveolar membranes. Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4) to the caveolae. Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity). Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway (By similarity). Negatively regulates TGFB1-mediated activation of SMAD2/3 by mediating the internalization of TGFBR1 from membrane rafts leading to its subsequent degradation.

PTMs:

Ubiquitinated. Undergo monoubiquitination and multi- and/or polyubiquitination. Monoubiquitination of N-terminal lysines promotes integration in a ternary complex with UBXN6 and VCP which promotes oligomeric CAV1 targeting to lysosomes for degradation.

The initiator methionine for isoform 2 is removed during or just after translation. The new N-terminal amino acid is then N-acetylated.

Phosphorylated at Tyr-14 by ABL1 in response to oxidative stress.

Subcellular Location:

Golgi apparatus membrane>Peripheral membrane protein. Cell membrane>Peripheral membrane protein. Membrane>Caveola>Peripheral membrane protein. Membrane raft. Golgi apparatus>trans-Golgi network.
Note: Colocalized with DPP4 in membrane rafts. Potential hairpin-like structure in the membrane. Membrane protein of caveolae.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Skeletal muscle, liver, stomach, lung, kidney and heart (at protein level). Expressed in the brain.

Family&Domains:

Belongs to the caveolin family.

Research Fields

· Cellular Processes > Transport and catabolism > Endocytosis.   (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.   (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Bacterial invasion of epithelial cells.

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

· Human Diseases > Cardiovascular diseases > Viral myocarditis.

References

1). SLC15A3 plays a crucial role in pulmonary fibrosis by regulating macrophage oxidative stress. Cell death and differentiation, 2024 (PubMed: 38374230) [IF=13.7]

Application: WB    Species: Mouse    Sample: lung tissues

Fig. 2: SLC15A3 deficiency protects mice from BLM-induced pulmonary fibrosis. A Appearance and morphology of lung tissues. B Assessment of lung index (lung wet weight (mg)/body weight (g)). C Changes of mouse body weight within 21 days after BLM (2 mg/kg) instillation. D Survival of WT and KO mice within 21 days after high dose (3 mg/kg) of BLM treatment, followed by Log-rank (Mantel-Cox) test. E Col1a1, Tgfb1, Fn1 mRNA expression in mouse lung. F, G Representative results and quantification of Col1, E-Cad, Arg1, and Cav-1 protein expression in mouse lung (n = 3, GAPDH served as a loading control. H H&E staining (top) and Masson staining (bottom) of mice lung sections. Scale bars: 50 μm (top left). I Extent of pulmonary fibrosis was quantified by Ashcroft score. J Lung hydroxyproline content. Data are represented as means ± SD, n = 6 for (B), (E), and (J). One-way ANOVA followed by Tukey’s multiple comparisons test for (B), (E), (G), (I), and (J), *P 

2). Stem cell membrane-coated isotretinoin for acne treatment. JOURNAL OF NANOBIOTECHNOLOGY, 2020 (PubMed: 32723398) [IF=10.2]

3). Curcumin alleviates visceral adiposity via inhibiting GIP release from hypoxic intestinal damage in MASH rats. NPJ science of food, 2025 (PubMed: 40500274) [IF=6.4]

Application: WB    Species: Rat    Sample:

Fig. 4: Effects of Cur on the liver and adipose tissue weights and indices, as well as adipose tissue inflammation and adipogenesis, in MASH rats. A Liver weight (n = 6). B Epididymal adipose tissue weight (n = 6). C Perirenal adipose tissue weight (n = 6). D Liver index (n = 6). E Epididymal adipose tissue index (n = 6). F Perirenal adipose tissue index (n = 6). G TNF-α and H IL-1β levels in epididymal adipose tissue (n = 6). I Representative Western blot bands of SREBP-1c, PPAR-γ, CAV-1 and PLIN1. J Quantitative analysis of the Western blot band densities of SREBP-1c, PPAR-γ, CAV-1 and PLIN1 (n = 3). K Representative Western blot bands of GIPR. L Quantitative analysis of the Western blot band densities of GIPR (n = 3). The data are presented as the mean ± SEM. #P 

4). Caveolin 1 ameliorates nonesterified fatty acid-induced oxidative stress via the autophagy regulator beclin 1 in bovine mammary gland epithelial cells. Journal of dairy science, 2025 (PubMed: 39414005) [IF=3.7]

Application: WB    Species: cow    Sample:

Figure 1. Changes in oxidative stress indicators, expression of caveolin 1 (CAV1) and autophagy-related proteins in mammary gland tissue of healthy cows (n = 15) and cows with clinical ketosis (n = 15). (A) Abundance of glutathione peroxidase (GSH-Px) and (B) catalase (CAT), and (C) activities of superoxide dismutase (SOD) and (D) malondialdehyde (MDA) in mammary gland tissue. (E) Representative blots of CAV1, beclin 1, autophagy-related gene 5 (ATG5), sequestosome-1 (SQSTM1, also called p62), and microtubule-associated protein 1 light chain (LC3). (F) Quantification of CAV1, beclin 1, ATG5, p62, and LC3, respectively. (G) mRNA abundance of CAV1, BECN1, ATG5, SQSTM1, and MAP1LC3. Statistical differences were analyzed by paired t-tests, and data were expressed as mean ± SEM. *P < 0.05, **P < 0.01, and ***P < 0.001 compared with healthy group.

5). Identification of prothymosin alpha (PTMA) as a biomarker for esophageal squamous cell carcinoma (ESCC) by label-free quantitative proteomics and Quantitative Dot Blot (QDB). Clinical Proteomics, 2019 (PubMed: 30988666) [IF=2.8]

Application: WB    Species: human    Sample: ESCC tissues

Fig. 5|The diferentially expressed proteins were validated by Western Blot. Compared with adjacent normal tissues, the protein expression of PTMA, PAK2, PPP1CA, HMGB2 were up-regulated (a, b), and the protein expression of Caveolin, Integrin beta-1, Collagen alpha-2(VI), Leiomodin-1, Vinculin were down-regulated in ESCC tissues from four pairs of samples (c, d). Representative immunoblot images (a, c) and histograms (mean ± SD; b, d).The experiments were repeated at least three times, N represented normal tissues and T represented tumor tissues

6). LOXL2 and SYVN1 cooperate across cellular compartments to drive liver hepatocellular carcinoma progression. Biochemical and biophysical research communications, 2026 (PubMed: 41447886) [IF=2.5]

7). The upregulation of caveolin-1 expression via the TLR4-Myd88 pathway contributes to cerebral vasospasm. Neurological research, 2025 (PubMed: 40263688) [IF=1.7]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.