PABPC1L2A; PABPC1L2B Antibody - #DF15280
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
PABPC1L2; PABPC1L2A; PABPC1L2B; PAP1M_HUMAN; Poly(A) binding protein, cytoplasmic 1 like 2A; Polyadenylate binding protein 1 like 2; Polyadenylate-binding protein 1-like 2; RBM32A; RBM32B; RNA binding motif protein 32; RNA binding protein 32; RNA-binding motif protein 32; RNA-binding protein 32; RP11-493K23.3;
Immunogens
A synthesized peptide derived from human PABPC1L2A; PABPC1L2B.
- Q5JQF8 PAP1M_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASLYVGDLHPEVTEAMLYEKFSPAGPILSIRICRDKITRRSLGYAYVNYQQPVDAKRALETLNFDVIKGRPVRIMWSQRDPSLRKSGVGNVFIKNLGKTIDNKALYNIFSAFGNILSCKVACDEKGPKGYGFVHFQKQESAERAIDVMNGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATLR
Research Backgrounds
Research Fields
· Genetic Information Processing > Translation > RNA transport.
· Genetic Information Processing > Translation > mRNA surveillance pathway.
· Genetic Information Processing > Folding, sorting and degradation > RNA degradation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.