DEGS1 Antibody - #DF15225
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Degenerative spermatocyte homolog 1; Degenerative spermatocyte homolog 1 lipid desaturase; Degenerative spermatocyte homolog lipid desaturase; DEGS 1; DEGS; Delta 4 desaturase sphingolipid 1; Des 1; DES1; Dihydroceramide desaturase; FADS7; Membrane fatty acid (lipid) desaturase; Membrane lipid desaturase; MGC5079; MIG15; Migration inducing gene 15 protein; MLD; Sphingolipid delta 4 desaturase; Sphingolipid delta(4) desaturase DES1;
Immunogens
A synthesized peptide derived from human DEGS1.
- O15121 DEGS1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGVDVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILIYYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE
Research Backgrounds
Has sphingolipid-delta-4-desaturase activity. Converts D-erythro-sphinganine to D-erythro-sphingosine (E-sphing-4-enine).
Myristoylation can target the enzyme to the mitochondria leading to an increase in ceramide levels.
Mitochondrion membrane. Endoplasmic reticulum membrane>Multi-pass membrane protein.
Ubiquitous.
Belongs to the fatty acid desaturase type 1 family. DEGS subfamily.
Research Fields
· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway. (View pathway)
· Metabolism > Lipid metabolism > Sphingolipid metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.