NXT2 Antibody - #DF15128
Product: | NXT2 Antibody |
Catalog: | DF15128 |
Description: | Rabbit polyclonal antibody to NXT2 |
Application: | ELISA(peptide) |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 16kD(Calculated). |
Uniprot: | Q9NPJ8 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
NTF2-related export protein 2; Nxt2; NXT2_HUMAN; Protein p15-2;
Immunogens
A synthesized peptide derived from human NXT2.
- Q9NPJ8 NXT2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATSLDFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQSTPNNTVWKIASDCFRFQDWSSS
Research Backgrounds
Regulator of protein export for NES-containing proteins. Also plays a role in mRNA nuclear export.
Nucleus. Cytoplasm.
Note: Shuttles between the nucleus and the cytoplasm.
Associates with NXF1, NXF2, NXF3 and NXF5.
Research Fields
· Genetic Information Processing > Translation > Ribosome biogenesis in eukaryotes.
· Genetic Information Processing > Translation > RNA transport.
· Genetic Information Processing > Translation > mRNA surveillance pathway.
· Human Diseases > Infectious diseases: Viral > Influenza A.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.