INIP Antibody - #DF15115
Product: | INIP Antibody |
Catalog: | DF15115 |
Description: | Rabbit polyclonal antibody to INIP |
Application: | ELISA(peptide) |
Reactivity: | Human, Mouse |
Mol.Wt.: | 11kD(Calculated). |
Uniprot: | Q9NRY2 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Chromosome 9 open reading frame 80; hSSBIP1; MISE; RP11-276E15.2; Sensor of single-strand DNA complex subunit C; Sensor of ssDNA subunit C; Single-stranded DNA-binding protein-interacting protein 1; SOSS C; SOSS complex subunit C; SOSS-C; SOSSC; SOSSC_HUMAN; SSB-interacting protein 1; Ssbip1;
Immunogens
A synthesized peptide derived from human INIP.
- Q9NRY2 SOSSC_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE
Research Backgrounds
Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways.
Nucleus.
Note: Localizes to nuclear foci following DNA damage.
Component of the SOSS complex, composed of SOSS-B (SOSS-B1/NABP2 or SOSS-B2/NABP1), SOSS-A/INTS3 and SOSS-C/INIP. SOSS complexes containing SOSS-B1/NABP2 are more abundant than complexes containing SOSS-B2/NABP1. Interacts with INTS3; the interaction is direct.
Belongs to the SOSS-C family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.