SSR2 Antibody - #DF15074
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Beta SSR; DKFZp686F19123; HSD25; Signal sequence receptor subunit beta; Signal sequence receptor, beta; Signal sequence receptor, beta (translocon associated protein beta); SRIF 1; SS2R; SSR 2; SSR beta; SSR-beta; ssr2; SSRB; SSRB_HUMAN; TLAP; Translocon associated protein beta; Translocon-associated protein subunit beta; TRAP BETA; TRAP-beta; TRAPB;
Immunogens
A synthesized peptide derived from human SSR2.
- P43308 SSRB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKTKKN
Research Backgrounds
TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins.
Endoplasmic reticulum membrane>Single-pass type I membrane protein.
Heterotetramer of TRAP-alpha, TRAP-beta, TRAP-delta and TRAP-gamma. Interacts with STING1.
Belongs to the TRAP-beta family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.