UBE2W Antibody - #DF15050
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
FLJ11011; hUBC 16; hUBC16; Probable ubiquitin conjugating enzyme E2 W; Probable ubiquitin-conjugating enzyme E2 W; UBC 16; UBC-16; UBC16; UBE 2W; ube2w; UBE2W_HUMAN; Ubiquitin carrier protein W; Ubiquitin conjugating enzyme 16; Ubiquitin conjugating enzyme E2 W; Ubiquitin conjugating enzyme E2W; Ubiquitin protein ligase W; Ubiquitin-protein ligase W;
Immunogens
A synthesized peptide derived from human UBE2W.
- Q96B02 UBE2W_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC
Research Backgrounds
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Specifically monoubiquitinates the N-terminus of various substrates, including ATXN3, MAPT/TAU, POLR2H/RPB8 and STUB1/CHIP, by recognizing backbone atoms of disordered N-termini. Involved in degradation of misfolded chaperone substrates by mediating monoubiquitination of STUB1/CHIP, leading to recruitment of ATXN3 to monoubiquitinated STUB1/CHIP, and restriction of the length of ubiquitin chain attached to STUB1/CHIP substrates by ATXN3. After UV irradiation, but not after mitomycin-C (MMC) treatment, acts as a specific E2 ubiquitin-conjugating enzyme for the Fanconi anemia complex by associating with E3 ubiquitin-protein ligase FANCL and catalyzing monoubiquitination of FANCD2, a key step in the DNA damage pathway. In vitro catalyzes 'Lys-11'-linked polyubiquitination. UBE2W-catalyzed ubiquitination occurs also in the presence of inactive RING/U-box type E3s, i.e. lacking the active site cysteine residues to form thioester bonds with ubiquitin, or even in the absence of E3, albeit at a slower rate.
Autoubiquitinated at Met-1.
Nucleus.
Note: In the nucleus, colocalizes with FANCL.
Widely expressed, with highest expression in brain, liver, pancreas and heart.
Belongs to the ubiquitin-conjugating enzyme family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.