GALNT1 Antibody - #DF15017
| Product: | GALNT1 Antibody |
| Catalog: | DF15017 |
| Description: | Rabbit polyclonal antibody to GALNT1 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 64kD(Calculated). |
| Uniprot: | Q10472 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
GALNAC T1; GalNAc transferase 1; GalNAc-T1; GALNT 1; GALNT1; GALT1_HUMAN; Polypeptide GalNAc transferase 1; Polypeptide N acetylgalactosaminyltransferase 1; Polypeptide N-acetylgalactosaminyltransferase 1 soluble form; pp GaNTase 1; pp-GaNTase 1; Protein UDP acetylgalactosaminyltransferase 1; Protein-UDP acetylgalactosaminyltransferase 1; UDP GalNAc:polypeptide N acetylgalactosaminyltransferase 1; UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 1 (GalNAc T1); UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 1; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1;
Immunogens
A synthesized peptide derived from human GALNT1.
- Q10472 GALT1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRKFAYCKVVLATSLIWVLLDMFLLLYFSECNKCDEKKERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCNGSRSQQWLLRNVTLPEIF
Research Backgrounds
Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a broad spectrum of substrates for peptides such as EA2, Muc5AC, Muc1a, Muc1b and Muc7.
Golgi apparatus>Golgi stack membrane>Single-pass type II membrane protein.
Secreted.
Widely expressed. Expressed in all tissues tested.
There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.
The ricin B-type lectin domain directs the glycopeptide specificity. It is required in the glycopeptide specificity of enzyme activity but not for activity with naked peptide substrates, suggesting that it triggers the catalytic domain to act on GalNAc-glycopeptide substrates (By similarity).
Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.
Research Fields
· Metabolism > Glycan biosynthesis and metabolism > Mucin type O-glycan biosynthesis.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.