Product: YAP Antibody
Catalog: AF6328
Description: Rabbit polyclonal antibody to YAP
Application: WB IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse, Rat, Monkey
Prediction: Pig, Zebrafish, Horse, Sheep, Rabbit, Chicken, Xenopus
Mol.Wt.: 65~78kD; 54kD(Calculated).
Uniprot: P46937
RRID: AB_2835184

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Monkey
Prediction:
Pig(100%), Zebrafish(100%), Horse(100%), Sheep(100%), Rabbit(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
YAP Antibody detects endogenous levels of total YAP.
RRID:
AB_2835184
Cite Format: Affinity Biosciences Cat# AF6328, RRID:AB_2835184.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

65 kDa Yes associated protein; 65 kDa Yes-associated protein; COB1; YAp 1; YAP 65; YAP; YAP1; YAP1_HUMAN; YAP2; YAP65; yes -associated protein delta; Yes associated protein 1 65kDa; Yes associated protein 1; Yes associated protein 2; yes associated protein beta; YKI; Yorkie homolog;

Immunogens

Immunogen:

A synthesized peptide derived from human YAP, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P46937 YAP1_HUMAN:

Increased expression seen in some liver and prostate cancers. Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level).

Description:
This gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction.
Sequence:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Sheep
100
Xenopus
100
Zebrafish
100
Chicken
100
Rabbit
100
Bovine
0
Dog
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Plays a key role in tissue tension and 3D tissue shape by regulating cortical actomyosin network formation. Acts via ARHGAP18, a Rho GTPase activating protein that suppresses F-actin polymerization. Plays a key role to control cell proliferation in response to cell contact. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. The presence of TEAD transcription factors are required for it to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction.

Isoform 2 and isoform 3 can activate the C-terminal fragment (CTF) of ERBB4 (isoform 3).

PTMs:

Phosphorylated by LATS1 and LATS2; leading to cytoplasmic translocation and inactivation. Phosphorylated by ABL1; leading to YAP1 stabilization, enhanced interaction with TP73 and recruitment onto proapoptotic genes; in response to DNA damage. Phosphorylation at Ser-400 and Ser-403 by CK1 is triggered by previous phosphorylation at Ser-397 by LATS proteins and leads to YAP1 ubiquitination by SCF(beta-TRCP) E3 ubiquitin ligase and subsequent degradation. Phosphorylated at Thr-119, Ser-138, Thr-154, Ser-367 and Thr-412 by MAPK8/JNK1 and MAPK9/JNK2, which is required for the regulation of apoptosis by YAP1.

Ubiquitinated by SCF(beta-TRCP) E3 ubiquitin ligase.

Subcellular Location:

Cytoplasm. Nucleus.
Note: Both phosphorylation and cell density can regulate its subcellular localization. Phosphorylation sequesters it in the cytoplasm by inhibiting its translocation into the nucleus. At low density, predominantly nuclear and is translocated to the cytoplasm at high density (PubMed:18158288, PubMed:20048001). PTPN14 induces translocation from the nucleus to the cytoplasm (PubMed:22525271).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Increased expression seen in some liver and prostate cancers. Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level).

Family&Domains:

The first coiled-coil region mediates most of the interaction with TEAD transcription factors.

Belongs to the YAP1 family.

Research Fields

· Environmental Information Processing > Signal transduction > Hippo signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Hippo signaling pathway - multiple species.   (View pathway)

References

1). Ultra-slippery, nonirritating, and anti-inflammatory hyaluronic acid-based coating to mitigate intubation injury. Chemical Engineering Journal, 2022 [IF=13.3]

2). YAP/TEAD1 and β-catenin/LEF1 synergistically induce estrogen receptor α to promote osteogenic differentiation of bone marrow stromal cells. MedComm, 2023 (PubMed: 37197086) [IF=9.9]

3). YAP maintains cartilage stem/progenitor cell homeostasis in osteoarthritis. Journal of orthopaedic translation, 2024 (PubMed: 38817242) [IF=5.9]

4). Resveratrol Inhibits the Tumorigenesis of Follicular Thyroid Cancer via ST6GAL2-Regulated Activation of the Hippo Signaling Pathway. Molecular Therapy-Oncolytics, 2020 (PubMed: 32055676) [IF=5.3]

Application: WB    Species: human    Sample: FTC238 cells

Figure 6. |Res Reduces ST6GAL2 Expression and Activates the Hippo Signaling Pathway in FTC Cells(A–D) The qPCR and western blotting results indicated that ST6GAL2 expression changes after Res treatment in FTC cells. (E–G) Expression of the main protein components of the Hippo signaling pathway in FTC238 cells was assessed by western blotting. Also shown is western blot analysis of nuclear YAP and TAZ expression in the indicated cells. The nuclear protein histone H3 was used as the nuclear protein marker

Application: WB    Species: human    Sample: FTC cells

Figure 4.| Upregulation of ST6GAL2 Rescues Tumorigenesis of FTC238 Cells and Resuppresses Hippo Signaling Pathway Activity(A–F) ST6GAL2 knockdown cells were transfected with ST6GAL2 overexpression vectors, and the proliferation,migration, and invasion capacities of FTC cells were enhanced. (G and H) Western blotting was performed to determine the levels of Hippo signaling molecules in FTC cells. *p < 0.05; scale bars, 20 mm.

5). CTNNAL1 participates in the regulation of mucus overproduction in HDM‐induced asthma mouse model through the YAP‐ROCK2 pathway. JOURNAL OF CELLULAR AND MOLECULAR MEDICINE, 2022 (PubMed: 35092120) [IF=5.3]

6). AT1R regulates macrophage polarization through YAP and regulates aortic dissection incidence. Frontiers in Physiology, 2021 (PubMed: 34305627) [IF=4.0]

Application: WB    Species: Mice    Sample: aortic tissue

FIGURE 8 ELISA and Western Blot results of aortic tissue in each group of mice. (A) ET-1 ELISA results were shown. Both telmisartan and nifedipine treatments can effectively reduce ET-1 serum levels in the AD mice model. Telmisartan is slightly better than nifedipine. (B) IL-6 ELISA results were shown. Both telmisartan and nifedipine treatments can effectively reduce IL-6 serum levels in the AD mice model. Telmisartan is slightly better than nifedipine. (C) MMP 9 ELISA results were shown. Both telmisartan and nifedipine treatments can effectively reduce MMP 9 serum levels in the AD mice model. Telmisartan is slightly better than nifedipine. (D) Western Blot results of YAP and AT1R content in aortic tissue of each group were demonstrated. The contents of AT1R and p-YAP in the aortic tissue of AD group were significantly increased, and the total content of YAP was decreased. Telmisartan treatment can effectively alleviate this phenomenon, and nifedipine cannot affect the expression of AT1R and YAP. (n = 3, mean and S.D., t-test, *P < 0.01 compared with control group; **P < 0.05 compared with the control group; ∧∧P < 0.05 compared with the AD group; ##P < 0.05 compared with the AD + telmisartan group).

7). Babaodan overcomes cisplatin resistance in cholangiocarcinoma via inhibiting YAP1. Pharmaceutical biology, 2024 (PubMed: 38571483) [IF=3.9]

Application: WB    Species: Human    Sample: CCAs

Figure 6. The extent of apoptosis, glutathione (GSH) synthesis, and the expression of DNA damage-related proteins were assessed in cholangiocarcinoma cells (CCAs) subjected to YAP1 knockdown or YAP1 overexpression. Western blot was used to measure protein levels (n = 3). With cisplatin incubation, YAP1 knockdown and 1 mg/mL babaodan (BBD) treatment decreased the (a) Bcl-2 level and (b) increased bax level, while the change in (c) cle-caspase-3/caspase-3 levels with BBD treatment was not statistically significant. In the CCAs dealing with cisplatin, the expression levels of (d) p-YAP1/YAP1, (e) ATF4, and (f) SLC1A5 were decreased by YAP1 knockdown and BBD treatment. Additionally, the (g) γH2Ax level was increased and (h) the ERCC1 level was inhibited by YAP1 knockdown and BBD treatment. YAP1 overexpression antagonized the effect of BBD on these proteins. Representative protein bands are shown in (i), (j), and (k). (mean ± standard deviation) +p 

8). Yes associated protein 1 promotes resistance to 5-fluorouracil in gastric cancer by regulating GLUT3-dependent glycometabolism reprogramming of tumor-associated macrophages. ARCHIVES OF BIOCHEMISTRY AND BIOPHYSICS, 2021 (PubMed: 33727040) [IF=3.8]

Application: IHC    Species: Mice    Sample: tumor tissues

Fig. 1. YAP1 is overexpressed in GC tumor tissues and is associated with 5-FU therapy resistance. A. RT-PCR was used to detect the mRNA expression of YAP1 in 32 paired GC and paired normal gastric mucosa samples. B. Representative YAP1 IHC staining in 81 GC samples and the statistical analysis. C-D. OS survival curve (n = 81), DFS survival curve of YAP1high and YAP1low groups that both treated with 5-FU (n = 81), respectively. (YAP1high and YAP1low group were divided by the IHC-P score of YAP1.) E. RT-PCR assay revealed the expression of YAP1 in AGS, MGC803, HGC27, SGC7901, MKN45, NCI–N87 cells. F–H. Verification of the siRNA and YAP1 plasmid by RT-PCR and Western blot. I-J. Tumor growth of MKN45 or MKN45-YAP1 in mice treated with Veh or 5-FU and representative photographs of tumor-bearing mice. K. MTT was used to detect the cell viability of MKN45 or MKN45-YAP1 that treated with 5-FU. All data presented are the mean ± SD (*p < 0.05, **p < 0.01) of triplicate determination from three independent experiments.

9). Mechanical and signaling responses of unloaded rat soleus muscle to chronically elevated β-myosin activity. Archives of biochemistry and biophysics, 2024 (PubMed: 38492659) [IF=3.8]

10). Indirect regulation of HIPPO pathway by miRNA mediates high-intensity intermittent exercise to ameliorate aging skeletal muscle function. Scandinavian journal of medicine & science in sports, 2023 (PubMed: 36789636) [IF=3.5]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.