SNX12 Antibody - #DF14856
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
2610001F05Rik; AW045757; MGC118982; MGC118983; RGD1565585; RP23-356J7.1; SDP8; SNX 12; SNX12; SNX12_HUMAN; Sorting nexin 12; Sorting nexin-12;
Immunogens
A synthesized peptide derived from human SNX12.
- Q9UMY4 SNX12_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVRQ
Research Backgrounds
May be involved in several stages of intracellular trafficking.
Membrane>Peripheral membrane protein>Cytoplasmic side.
The PX domain mediates interaction with membranes enriched in phosphatidylinositol 3-phosphate.
Belongs to the sorting nexin family.
Research Fields
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.