HPGD Antibody - #DF14850
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
15 hydroxyprostaglandin dehydrogenase [NAD+]; 15 PGDH; 15-hydroxyprostaglandin dehydrogenase [NAD+]; 15-PGDH; 15PGDH; Hpgd; Hydroxyprostaglandin dehydrogenase 15 (NAD); NAD+ dependent 15 hydroxyprostaglandin dehydrogenase; OTTHUMP00000218960; OTTHUMP00000219016; OTTHUMP00000219018; PGDH; PGDH_HUMAN; PGDH1; PHOAR1; Prostaglandin dehydrogenase 1; SDR36C1; Short chain dehydrogenase/reductase family 36C member 1;
Immunogens
A synthesized peptide derived from human HPGD.
- P15428 PGDH_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ
Research Backgrounds
Prostaglandin inactivation. Contributes to the regulation of events that are under the control of prostaglandin levels. Catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4. Inhibits in vivo proliferation of colon cancer cells.
Cytoplasm.
Detected in colon epithelium (at protein level).
Homodimer.
Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Research Fields
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.