Product: ST3GAL2 Antibody
Catalog: DF14827
Description: Rabbit polyclonal antibody to ST3GAL2
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 40kD(Calculated).
Uniprot: Q16842

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
ST3GAL2 Antibody detects endogenous levels of ST3GAL2.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

3-GalNAc-alpha-2; 3-sialyltransferase 2; 3-sialyltransferase; 3-ST 2; Alpha 2; Alpha 2,3-ST; Beta-galactoside alpha-2; Beta-galactoside alpha-2,3-sialyltransferase; CMP N-acetylneuraminate beta galactosamide alpha 2,3 sialyltransferase; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2; Gal NAc6S; Gal-beta-1; Gal-NAc6S; SIA4B_HUMAN; sialyltransferase 4B (beta-galactosidase alpha-2,3-sialytransferase); Sialyltransferase 4B; SIAT4-B; SIAT4B; ST3 beta-galactoside alpha-2,3-sialyltransferase 2; ST3Gal II; ST3GAL2; ST3GalA.2; ST3GalII;

Immunogens

Immunogen:

A synthesized peptide derived from human ST3GAL2.

Uniprot:
Gene(ID):
Expression:
Q16842 SIA4B_HUMAN:

Highly expressed in skeletal muscle and heart and to a much lesser extent in brain, placenta, liver and pancreas. Scarcely detectable in lung and kidney.

Sequence:
MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMNQAPTVGFEQDVGSRTTHHFMYPESAKNLPANVSFVLVPFKVLDLLWIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFGADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN

Research Backgrounds

Function:

Responsible for the synthesis of the sequence NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- found in terminal carbohydrate groups of certain glycoproteins, oligosaccharides and glycolipids. SIAT4A and SIAT4B sialylate the same acceptor substrates but exhibit different Km values.

PTMs:

The soluble form derives from the membrane form by proteolytic processing.

Subcellular Location:

Golgi apparatus>Golgi stack membrane>Single-pass type II membrane protein. Secreted.
Note: Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly expressed in skeletal muscle and heart and to a much lesser extent in brain, placenta, liver and pancreas. Scarcely detectable in lung and kidney.

Family&Domains:

Belongs to the glycosyltransferase 29 family.

Research Fields

· Metabolism > Glycan biosynthesis and metabolism > Mucin type O-glycan biosynthesis.

· Metabolism > Glycan biosynthesis and metabolism > Glycosaminoglycan biosynthesis - keratan sulfate.

· Metabolism > Glycan biosynthesis and metabolism > Glycosphingolipid biosynthesis - globo and isoglobo series.

· Metabolism > Glycan biosynthesis and metabolism > Glycosphingolipid biosynthesis - ganglio series.

· Metabolism > Global and overview maps > Metabolic pathways.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.