RDH11 Antibody - #DF14771
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Androgen regulated short chain dehydrogenase/reductase 1; Androgen-regulated short-chain dehydrogenase/reductase 1; ARSDR1; AU045252; C85936; CGI 82; FLJ32633; HCBP12; HCV core binding protein; HCV core binding protein HCBP12; HCV core-binding protein HCBP12; MDT1; Prostate short chain dehydrogenase/reductase 1; Prostate short-chain dehydrogenase/reductase 1; PSDR1; RALR1; RDH11; RDH11_HUMAN; Retinal reductase 1; retinol dehydrogenase 11 (all trans/9 cis/11 cis); Retinol dehydrogenase 11; SCALD; SDR7C1; Short chain dehydrogenase/reductase family 7C, member 1;
Immunogens
A synthesized peptide derived from human RDH11.
Predominantly expressed in the epithelial cells of prostate, in both basal and luminal secretory cell populations. Expressed at low levels in spleen, thymus, testis, ovary, small intestine, colon, peripherical blood leukocytes, kidney, adrenal gland and fetal liver. Not detected in prostatic fibromuscular stromal cells, endothelial cells, or infiltrating lymphocytes.
- Q8TC12 RDH11_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVELMFPLLLLLLPFLLYMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID
Research Backgrounds
Retinol dehydrogenase with a clear preference for NADP. Displays high activity towards 9-cis, 11-cis and all-trans-retinol, and to a lesser extent on 13-cis-retinol. Exhibits a low reductive activity towards unsaturated medium-chain aldehydes such as cis -6-nonenal and no activity toward nonanal or 4-hydroxy-nonenal. Has no dehydrogenase activity towards steroid.
Not glycosylated.
Endoplasmic reticulum membrane>Single-pass type II membrane protein.
Predominantly expressed in the epithelial cells of prostate, in both basal and luminal secretory cell populations. Expressed at low levels in spleen, thymus, testis, ovary, small intestine, colon, peripherical blood leukocytes, kidney, adrenal gland and fetal liver. Not detected in prostatic fibromuscular stromal cells, endothelial cells, or infiltrating lymphocytes.
Interacts with SELENOF.
Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Research Fields
· Metabolism > Metabolism of cofactors and vitamins > Retinol metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.