PLA2G12B Antibody - #DF14765
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
2010002E04Rik; FKSG71; Group XIIB phospholipase A2; Group XIII secreted phospholipase A2; GXIIB; GXIIIsPLA2; MGC138151; Phospholipase A2, group XIIB; PLA2G12B; PLA2G13;
Immunogens
A synthesized peptide derived from human PLA2G12B.
- Q9BX93 PG12B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKLASGFLVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCRYGKAPMPRPGYKPQEPNGCGSYFLGLKVPESMDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSKVEAACDSLVDTVFNTVWTLGCRPFMNSQRAACICAEEEKEEL
Research Backgrounds
Not known; does not seem to have catalytic activity.
Secreted.
Strong expression in liver, small intestine and kidney.
Belongs to the phospholipase A2 family.
Research Fields
· Environmental Information Processing > Signal transduction > Ras signaling pathway. (View pathway)
· Metabolism > Lipid metabolism > Glycerophospholipid metabolism.
· Metabolism > Lipid metabolism > Ether lipid metabolism.
· Metabolism > Lipid metabolism > Arachidonic acid metabolism.
· Metabolism > Lipid metabolism > Linoleic acid metabolism.
· Metabolism > Lipid metabolism > alpha-Linolenic acid metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Circulatory system > Vascular smooth muscle contraction. (View pathway)
· Organismal Systems > Digestive system > Pancreatic secretion.
· Organismal Systems > Digestive system > Fat digestion and absorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.