Product: UGT2B15 Antibody
Catalog: DF14740
Description: Rabbit polyclonal antibody to UGT2B15
Application: IF/ICC
Reactivity: Human
Mol.Wt.: 61kD(Calculated).
Uniprot: P54855

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
UGT2B15 Antibody detects endogenous levels of UGT2B15.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

EC 2.4.1.17; HLUG4; UDB15_HUMAN; UDP glucuronosyltransferase 2 family polypeptide B15; UDP glucuronosyltransferase 2 family, member B15; UDP glucuronosyltransferase 2 family, member B8; UDP glucuronosyltransferase 2B15; UDP glucuronosyltransferase UGT2B15; UDP glucuronyltransferase family 2 beta 15; UDP glycosyltransferase 2 family, member B15; UDP glycosyltransferase 2B15; UDP-glucuronosyltransferase 2B15; UDP-glucuronosyltransferase 2B8; UDPGT 2B15; UDPGT 2B8; UDPGT2B15; UDPGTh 3; UDPGTh-3; UDPGTH3; UGT2B15; UGT2B8; Uridine diphosphate glucuronosyltransferase 2 family, member B8; Uridine diphosphate glycosyltransferase 2 family, member B15;

Immunogens

Immunogen:

A synthesized peptide derived from human UGT2B15.

Uniprot:
Gene(ID):
Expression:
P54855 UDB15_HUMAN:

Expressed in many tissues. Present in liver, prostate and testis.

Sequence:
MSLKWTSVFLLIQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSASTLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMKLQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIHMLYFDFWFQIYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPVYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATVIFIITKFCLFCFRKLAKKGKKKKRD

Research Backgrounds

Function:

UDPGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isozyme displays activity toward several classes of xenobiotic substrates, including simple phenolic compounds, 7-hydroxylated coumarins, flavonoids, anthraquinones, and certain drugs and their hydroxylated metabolites. It also catalyzes the glucuronidation of endogenous estrogens and androgens.

Subcellular Location:

Microsome membrane>Single-pass membrane protein. Endoplasmic reticulum membrane>Single-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in many tissues. Present in liver, prostate and testis.

Family&Domains:

Belongs to the UDP-glycosyltransferase family.

Research Fields

· Human Diseases > Cancers: Overview > Chemical carcinogenesis.

· Metabolism > Carbohydrate metabolism > Pentose and glucuronate interconversions.

· Metabolism > Carbohydrate metabolism > Ascorbate and aldarate metabolism.

· Metabolism > Lipid metabolism > Steroid hormone biosynthesis.

· Metabolism > Metabolism of cofactors and vitamins > Retinol metabolism.

· Metabolism > Metabolism of cofactors and vitamins > Porphyrin and chlorophyll metabolism.

· Metabolism > Xenobiotics biodegradation and metabolism > Metabolism of xenobiotics by cytochrome P450.

· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - cytochrome P450.

· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - other enzymes.

· Metabolism > Global and overview maps > Metabolic pathways.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.