Product: RHOU Antibody
Catalog: DF14711
Description: Rabbit polyclonal antibody to RHOU
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 28kD(Calculated).
Uniprot: Q7L0Q8

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500, IHC 1:50-1:200, WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
RHOU Antibody detects endogenous levels of RHOU.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ARHU; CDC42 L1; CDC42 like GTPase; CDC42-like GTPase 1; CDC42L1; G28K; GTP binding protein like 1; GTP binding protein SB128; GTP-binding protein-like 1; hG28K; mG28K; Ras homolog gene family member U; Ras homolog gene family member U isoform CRA a; Ras like gene family member U; Rho GTPase like protein ARHU; Rho GTPase-like protein ARHU; Rho related GTP binding protein RhoU; Rho-related GTP-binding protein RhoU; Rhou; RHOU_HUMAN; Ryu GTPase; Wnt-1 responsive Cdc42 homolog 1; Wnt1 responsive Cdc42 homolog; WRCH 1; WRCH-1;

Immunogens

Immunogen:

A synthesized peptide derived from human RHOU.

Uniprot:
Gene(ID):
Expression:
Q7L0Q8 RHOU_HUMAN:

Ubiquitously expressed in all tissues examined. Expressed at high levels in the stomach, small intestine, brain, skeletal muscle and placenta.

Sequence:
MPPQQGDPAFPDRCEAPPVPPRRERGGRGGRGPGEPGGRGRAGGAEGRGVKCVLVGDGAVGKTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFDKLRPLCYTNTDIFLLCFSVVSPSSFQNVSEKWVPEIRCHCPKAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAAKLCAEEIKAASYIECSALTQKNLKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV

Research Backgrounds

Function:

Acts upstream of PAK1 to regulate the actin cytoskeleton, adhesion turnover and increase cell migration. Stimulates quiescent cells to reenter the cell cycle. Has no detectable GTPase activity but its high intrinsic guanine nucleotide exchange activity suggests it is constitutively GTP-bound. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape.

PTMs:

Tyrosine phosphorylated by SRC in response to PTK2B/PYK2 activation.

Subcellular Location:

Cell membrane>Lipid-anchor>Cytoplasmic side. Golgi apparatus membrane>Lipid-anchor. Cell junction>Focal adhesion. Cell projection>Podosome.
Note: Localizes to podosomes in SRC-transformed cells.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitously expressed in all tissues examined. Expressed at high levels in the stomach, small intestine, brain, skeletal muscle and placenta.

Subunit Structure:

Interacts with PAK3. Interacts with ARHGAP30 in a GTP-independent manner. In its GTP-loaded conformation, interacts with ARHGAP31. Interacts with PTK2B/PYK2.

Family&Domains:

Belongs to the small GTPase superfamily. Rho family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.