RAMP3 Antibody - #DF14693
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Calcitonin receptor like receptor activity modifying protein 3; CRLR activity modifying protein 3; CRLR activity-modifying protein 3; OTTHUMP00000159549; OTTHUMP00000214279; OTTHUMP00000214280; Receptor (calcitonin) activity modifying protein 3; Receptor (G protein-coupled) activity modifying protein 3; Receptor activity modifying protein 3;
Immunogens
A synthesized peptide derived from human RAMP3.
- O60896 RAMP3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL
Research Backgrounds
Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) and GPER1 to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL.
Cell membrane>Single-pass type I membrane protein. Membrane>Single-pass type I membrane protein.
Note: Moves from intracellular puncta to the plasma membrane in a RAMP3-dependent manner.
Strongly expressed in lung, breast, immune system and fetal tissues.
Heterodimer of CALCRL and RAMP3 (By similarity). Interacts with GPER1.
Belongs to the RAMP family.
Research Fields
· Organismal Systems > Circulatory system > Vascular smooth muscle contraction. (View pathway)
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.